KEGG   Azospira oryzae: Dsui_1522Help
Entry
Dsui_1522         CDS       T01657                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dsu  Azospira oryzae
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dsu01001]
    Dsui_1522
Enzymes [BR:dsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dsui_1522
Protein kinases [BR:dsu01001]
 Serine/threonine kinases: Other
  Bacterial family
   Dsui_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH PEGA Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-ProteinID: AEV25911
UniProt: G8QP58
LinkDB All DBs
Position
complement(1584010..1585344)
Genome map
AA seq 444 aa AA seqDB search
MTIQQLGRYRIDGVLGEGAMGVVYRAFDPLLERVVAIKTIKFDASLSEKESFERRFFREA
KSVARLSHPAIVTLYDAGKAEDVAYMAMEFLEGRELRRFISEAGPLPYTRIADMMAAVAD
GLDYAHRQGVVHRDIKPANLMVLADGAVKITDFGIAQLQTGSKTMTGHMLGTPKYMAPEQ
IMGHPVDGRADIFSLGVVLYQWLTGVAPFDGETVTTIMYRVINEGPVLPTRLMPELPPGF
EAILAKALAKSPEERYQTAGELAADLRRYAELGSPGPVLGLAAQAQPQPRIPPSPSEDPT
MLLAHPFTDTNPLSLSPAPQEAPASPPARRGKALWLGIAAVAIAGGAFALLPTERSAGNG
ATPAPAASTAAPEPQPAARVDLAIAPWGEVVVDGEPKGISPPLESIELLPGHHEVEIRNG
QSEPHRLTLELGAGDTYKIKHKFK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcaacaactgggccgctaccgtatcgacggagtactcggcgagggagccatg
ggcgtggtgtaccgcgccttcgatcccctgctggaacgggtcgtggccatcaagaccatc
aagttcgacgccagcctgtccgagaaggagagcttcgagcgccgcttcttccgcgaggcc
aagtcggtcgcccgcctcagccacccggccatcgtcaccctgtacgacgcgggcaaggcg
gaggacgtggcctacatggccatggaattcctcgaaggccgggaactgcgccgcttcatc
agcgaagccggccccctgccctacacccgcatcgccgacatgatggccgccgtcgccgac
ggcctggactacgcccaccgccagggcgtggtgcaccgggacatcaagccggccaacctc
atggtgctggccgacggcgccgtgaaaatcaccgatttcggcatcgcccagctgcagacc
ggcagcaagaccatgaccggccacatgctgggcacgcccaagtacatggcgccggagcag
atcatgggccatccggtggacggccgggccgacatcttctccctcggcgtggtgctctac
cagtggctcaccggcgtcgcccccttcgacggcgaaacggtcaccaccatcatgtaccgg
gtcatcaacgaaggcccggtgctgcccacccggctcatgccggaactgccgccgggcttc
gaggccatcctggccaaggccctggccaagtcgccggaggaacgctaccagaccgccggc
gaactggccgccgacctgcgccgctacgccgagctcggctcccccggcccggtcctcggc
ctggccgcccaggcccagccccagccgcgcattccgcccagcccgtcggaagatccgacc
atgctgctggcccacccgttcacggacaccaaccccctcagcctctcccctgcgccccag
gaagcaccggcctcgccgccggcacgccgcggcaaggcgctgtggttgggcatcgccgcg
gtggccatcgccggcggcgcattcgccctgctgcccacggaacgcagtgccggcaacggc
gccacgcctgcccctgcggccagtactgcagcgcccgaaccccagcccgccgcccgggtg
gacctggccatcgccccctggggcgaagtggtggtggacggcgaacccaagggcatctcg
ccgcccctggaaagcatcgagctgctgccgggccaccacgaggtggaaatccgcaacggc
cagtccgaaccccatcgcctgaccctggaactgggcgccggcgacacctacaagatcaag
cacaaattcaaatga

DBGET integrated database retrieval system