KEGG   Azospira oryzae: Dsui_1902Help
Entry
Dsui_1902         CDS       T01657                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dsu  Azospira oryzae
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dsui_1902
Enzymes [BR:dsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Dsui_1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like DAO FAD_binding_2 AlaDh_PNT_C Glutaredoxin Thi4 FAD_binding_3 NAD_binding_8 FMO-like K_oxygenase NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AEV26277
UniProt: G8QHD2
LinkDB All DBs
Position
2000980..2002542
Genome map
AA seq 520 aa AA seqDB search
MLDSSIKTQLKAYLEKLVQPIELVASLDDSATAQEMRSLLADIAELSDKVSLREDGQAAR
RPSFGIARAGQSPRIHFAGIPMGHEFTSLVLALLQSGGHPPKVEAEVVEQIKGLDGKFSF
ETFISLSCHNCPDVVQALNTMAVLNPNVEAVMIDGGVFQQEVEERQIMGVPAIYLNGQAF
GSGRMELGEILAKVDTGAAARDAAKLSDKEVFDVLVVGGGPAGAAAAIYAARKGIRTGVV
AERFGGQVLDTLGIENFISVKETEGPKLAMALEQHVREYEVDIMNLQRAAALKPAANGQP
AEVTLANGAVLKSKTVILSTGARWREMNVPGEAEYRTKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFGKEMRADAVLQKKLLSLPNVTVITEAQTTEVTGDGQ
KVNGLKYKDRVSGEEKTVALEGIFVQIGLLPNTDWLKGTVELSDRGEIVINAKGETSAEG
VFAAGDCTTVPYKQIIIAMGEGAKASLSAFDHLIRSSALA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacagcagcatcaagacccagctcaaggcttaccttgaaaaactcgtccagccc
atcgaactggtggcctccctggacgattccgccaccgcccaggaaatgcgcagcctgctg
gccgacatcgccgagctgtccgacaaggtgagtctgcgcgaagacggccaggccgcacgc
cgtccctctttcggcatcgcccgggccggccagagtccccgcatccatttcgccggcatc
cccatgggccacgaattcacctccctggtgctggccctgctgcagagcggcggtcacccg
cccaaggtggaggccgaggtggtcgagcagatcaagggcctggacggcaagttcagcttc
gagaccttcatctccctctcctgccacaactgcccggacgtggtgcaggccctcaacacc
atggccgtgctcaaccccaatgtggaagcggtgatgatcgatggcggcgtcttccagcag
gaagtggaagagcgccagatcatgggcgtgcccgccatctacctcaacggccaggccttc
ggctccggccgcatggaactgggcgaaatcctggccaaggtggatacgggcgctgccgcc
cgggatgcggccaagctctccgacaaggaagtgttcgacgtgctggtggtgggcggtggc
ccggccggcgccgccgccgccatctacgccgcccgcaagggtatccgcaccggcgtggtg
gccgagcgtttcggcggccaggtgctggacaccctgggcatcgagaacttcatttccgtc
aaggaaaccgaaggccccaagctggccatggccctggagcagcacgtgcgcgaatacgag
gtggacatcatgaacctgcagcgcgccgccgccctcaagcccgccgccaacggccagccc
gccgaagtgaccctggccaacggcgccgtgttgaagagcaagaccgtgatcctctccacc
ggcgcccgctggcgtgaaatgaacgtgcccggcgaagccgagtaccgcaccaagggcgtg
gcctactgcccccactgcgacggccccctgttcaagggcaagcgcgtcgccgtgatcggc
ggcggcaactccggcgtcgaggctgcaatcgacctggccggcatcgtcgcccacgtcacc
ctgctggaattcggcaaggaaatgcgggccgacgccgtgctgcagaagaagctgctcagc
ctgcctaacgtcacggtgattaccgaagcccagaccacggaagtgaccggtgacggccag
aaggtgaacggcctcaagtacaaggaccgggtcagcggcgaggaaaagaccgtcgccctg
gaaggcatcttcgtgcagatcggcctgctgcccaacaccgattggctcaagggcaccgtc
gaactctccgaccggggcgagatcgtcatcaacgccaagggcgagacctccgccgaaggc
gtcttcgccgccggcgactgcaccaccgtgccctacaagcagatcatcatcgccatgggc
gagggcgccaaagccagcctctcggccttcgaccacctgatccgcagctcggccctggcc
tga

DBGET integrated database retrieval system