KEGG   Azospira oryzae: Dsui_2466Help
Entry
Dsui_2466         CDS       T01657                                 

Definition
(GenBank) ATP dependent DNA ligase-like protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dsu  Azospira oryzae
Pathway
dsu03030  DNA replication
dsu03410  Base excision repair
dsu03420  Nucleotide excision repair
dsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Dsui_2466
   03410 Base excision repair
    Dsui_2466
   03420 Nucleotide excision repair
    Dsui_2466
   03430 Mismatch repair
    Dsui_2466
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dsu03032]
    Dsui_2466
   03400 DNA repair and recombination proteins [BR:dsu03400]
    Dsui_2466
Enzymes [BR:dsu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Dsui_2466
    6.5.1.6  DNA ligase (ATP or NAD+)
     Dsui_2466
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Dsui_2466
DNA replication proteins [BR:dsu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Dsui_2466
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Dsui_2466
DNA repair and recombination proteins [BR:dsu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Dsui_2466
   NER (nucleotide excision repair)
    Other NER factors
     Dsui_2466
   MMR (mismatch exicision repair)
    Other MMR factors
     Dsui_2466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AEV26824
UniProt: G8QMJ2
LinkDB All DBs
Position
2622777..2623622
Genome map
AA seq 281 aa AA seqDB search
MIRRLLLLLLSLGWSPLWAQSPTVPPPPLLLAETYTGQEDVAAYWVSEKLDGVRAVWDGQ
VLRFRSGRPVAAPAWFVAALPATPLDGELWAGRGHFERLSATVRRELPDDAEWRQVRYMV
FELPGGEGAFSERLQRLQALVAGARVPWLQTVEQFRLANRAQLLARLEEVRRGGGEGLML
HRADAPYVTGRSEVLLKVKPWLDAEARVVAHLPGKGRYAGMLGALRVEMPDGRRFSLGTG
FSAAERRQPPPVGALITYRYRELTATGLPRFASYWRVRQDF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatccgccgcctgctgctcctgcttctctcccttggctggagcccgctgtgggcccag
tcccccaccgttccgccgccgcccctgctcctggccgaaacctacaccggccaggaggac
gtggccgcctactgggtcagtgaaaagctggacggggtcagggcggtctgggacggccag
gtgctgcgctttcgcagcggccgcccggtggcggcgccggcctggtttgtcgcggcactg
ccggccacgcccctggatggggaattgtgggccgggcgcggccatttcgagcggctctcg
gccacggtgcggcgggaactgccggacgatgccgaatggcggcaggtgcgctacatggtg
ttcgaactgccgggcggggagggcgctttcagcgagcggttgcagcgcctgcaagcgctg
gtggccggcgcccgggtgccctggctgcagacggtggagcagttccgcctggcgaacagg
gctcagttgctggcccggctggaggaagtgcggcggggcggcggcgaaggcctgatgctg
catcgggccgatgcgccctatgtcaccggccgcagcgaggtgctgctcaaggtgaaaccc
tggctcgatgcggaggcccgagtggtggcccatttgccgggcaagggccgctacgccggc
atgctgggggcgctgcgggtggagatgcccgatggccgccggttcagcctgggcaccggc
ttttccgccgcagagcggcgtcagccgccgcccgtgggggccctgattacctaccgctat
cgggaactgacagctacgggcctgccccgttttgccagctactggcgggtgcggcaggat
ttctga

DBGET integrated database retrieval system