KEGG   Azospira oryzae: Dsui_3156Help
Entry
Dsui_3156         CDS       T01657                                 

Definition
(GenBank) putative permease
  KO
K07090  uncharacterized protein
Organism
dsu  Azospira oryzae
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Dsui_3156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AEV27488
UniProt: G8QI85
LinkDB All DBs
Position
3378540..3379313
Genome map
AA seq 257 aa AA seqDB search
MPHDLLSPPLLLACIALIVGIAAFAHGVIGVGFPLITTPCIALLTDLKTAVLITVLPNIL
LNILSILRGGNWRNSLLKHWRLAAYVLLGSLVGTQLLIGLPAEPLKLALALMMLVSINLN
RLKKLDWSFLRRHRRTSEAAFGLIGGILSGTVNVSVPPLAIYFIGLDLSPVATVQLFNLC
FIVGKLTQAGTLAAHGEFTAAILWQSAGLTVLAVACLIPGMRIQSRMDATTYRRWLNHTL
LLMAVLMLVQVGLAWAR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgccccacgatttgctctccccgcccctgctgctggcctgcatcgccctcatcgtcggt
atcgccgccttcgcccacggggtcatcggcgtcggtttccccctcatcaccacgccctgc
atcgccctcctcaccgacttgaagacggcggtgctgatcacggtgctgcccaacatcctg
ctcaacatcctctccatcctgcgcggcggcaactggcggaacagcctgctcaagcactgg
cgcctggccgcctacgtgctgctgggcagcctggtgggcacccagctgctgatcggcctg
ccggccgagcccctgaagctggccctggccctgatgatgctcgtttccatcaacctcaac
cgcctgaagaagctggactggtccttcctgcgccgccaccgccgcacctcggaagcggcc
ttcggcctcatcggcggcattctctcgggcaccgtcaatgtctcggtgccgcccctggcc
atctacttcatcggcctggacctttcccccgtggccacggtgcagctgttcaacctctgc
ttcatcgtcggcaagctgacccaggccgggaccctggccgcccacggcgaattcaccgcc
gccatcctgtggcagagcgccggcctcaccgtgctggccgtggcctgtctcattcccggc
atgcgcatccagtcccgcatggacgccaccacctaccggcgctggctcaaccacaccctg
ctgctgatggccgtcctcatgctggtccaggtcggcctggcctgggcccgctag

DBGET integrated database retrieval system