KEGG   Azospira oryzae: Dsui_3295Help
Entry
Dsui_3295         CDS       T01657                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent, monomeric type
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
dsu  Azospira oryzae
Pathway
dsu00020  Citrate cycle (TCA cycle)
dsu00480  Glutathione metabolism
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01120  Microbial metabolism in diverse environments
dsu01130  Biosynthesis of antibiotics
dsu01200  Carbon metabolism
dsu01210  2-Oxocarboxylic acid metabolism
dsu01230  Biosynthesis of amino acids
Module
dsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dsu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dsui_3295
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dsui_3295
Enzymes [BR:dsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Dsui_3295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AEV27626
UniProt: G8QJF7
LinkDB All DBs
Position
3535470..3537710
Genome map
AA seq 746 aa AA seqDB search
MSAGKSKIIYTLTDEAPLLATCAFLPIIRTFTGPAGVEIAESDISVAARVLAEFSDYLRD
DQKVPDNLAELGRLTQDPDTNIIKLPNISASVAQLVACVKELQAKGYAIPDYPENPTTDE
EKALKTRYGKCLGSAVNPVLREGNSDRRAPAAVKNYAKKHPHSMGEWKPWSQTHVAHMDH
GDFYHGEKSLTLDKARDVKMELVTKSGKTIVLKPKVALKDGEIIDSMFMSKKALCDFYEK
ELEDCRQAGILFSLHVKATMMKVSHPIVFGHCVKIYYKEAFEKHGKLFDELGINVNNGMA
TLYEKIDTLPESKRDEIIRDLHACQEHRPRLAMVDSAKGITNFHSPNDIIVDASMPAMIR
GGGKMWGADGKPYDCKAVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEAGIANIVDLATGEVLLSQNVEEGDIWRMCQVKDEPIRDWVKLAVTRA
RNSGMPAVFWLDPYRPHEAELIKKVEKYLKDHDTSGLEIHIMSQVRAMRFTLERVARGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEELGIKTGNAKAKLLAKTLDEATGKLLDENKSPSRRTGELDNR
GSQFYLALYWAQALAAQSEDKDLATKFGPLAKSLAENEQKIVDELKAVQGKPVDIGGYYL
ADQAKVTAVMRPSATLNSLLQAASAA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctggtaagtcgaagatcatttacacgctcactgatgaggcgcccctgctggcg
acctgtgcttttctgccgatcatccgcaccttcaccggtccggccggcgttgaaatcgcc
gaaagcgacatttccgtggccgcccgtgtcctggccgaattctccgactacctgcgcgac
gaccagaaggttccggacaacctggccgaactgggccgcctgacccaggaccccgacacc
aacatcatcaagctgcccaacatcagcgcctccgtggcccagctggtggcttgcgtcaag
gaactgcaggccaagggctacgccatcccggactacccggaaaaccccaccacggacgag
gaaaaggccctcaagacccgctacggcaagtgcctgggctccgccgtgaatccggtgctg
cgcgaaggcaactccgaccgccgcgcccccgccgccgtcaagaactacgccaagaagcac
ccccactccatgggtgaatggaagccctggtcccagacccacgtggcccacatggaccac
ggcgacttctaccacggcgaaaagtccctgaccctggacaaggcccgggacgtgaagatg
gagctggtcaccaagagcggcaagaccatcgtgctgaagcccaaggtggccctcaaggac
ggcgagatcatcgactccatgttcatgagcaagaaggccctgtgcgacttctacgagaag
gaactggaagactgccggcaggccggcatcctcttctccctgcacgtgaaggccaccatg
atgaaggtgtcccaccccatcgtcttcggccactgcgtcaagatctactacaaggaagcc
ttcgagaagcacggcaagctgttcgacgagctgggcatcaacgtcaacaacggcatggcc
accctctacgagaagatcgacaccctgcccgaatccaagcgcgacgagatcatccgcgac
ctgcacgcctgccaggagcaccgtccccgtctggccatggtggattccgccaagggcatc
accaacttccactcccccaacgacatcatcgtggacgcttccatgcccgccatgatccgc
ggcggcggcaagatgtggggtgccgacggcaagccttacgactgcaaggccgtgatgccc
gaatccaccttcgcccgcatctaccaggagatgatcaacttctgtaagtggcacggcaac
ttcgatcccaagaccatgggcaccgtgcccaacgtcggcctgatggcccagaaggccgag
gaatacggctcccacgacaagaccttcgaaatcgccgaagccggcatcgccaacattgtg
gacctggccaccggcgaagttctgctgtcccagaacgtggaagaaggcgacatctggcgc
atgtgccaggtgaaggacgagccgatccgcgactgggtcaagctggccgtcacccgcgcc
cgcaactccggcatgcccgccgtcttctggctggacccctaccgtccccacgaagccgag
ctgatcaagaaggtggagaagtacctcaaggatcacgacaccagcggcctggaaatccac
atcatgtcccaggtgcgtgccatgcgcttcaccctggaacgggtcgcccgcggcctggac
accatctccgtcaccggcaacatcctgcgcgactacctgaccgacctgttccccatcatg
gaactgggcacctccgccaagatgctctccatcgttcccctgatggctggtggcggcatg
tacgaaaccggtgccggcggctccgcgcccaagcacgtgcagcagctggtggaagaaaac
cacctgcgctgggattccctgggcgagttcctggccctggccgtgtccctggaagagctg
ggcatcaagaccggcaacgccaaggccaagctgctggccaagaccctggatgaggccacc
ggcaagctgctggacgagaacaagtccccctcccgccgtaccggcgagctggacaaccgg
ggcagccagttctacctggctctgtactgggcccaggccctggccgcccagtccgaggac
aaggacctggccaccaagttcggccccctggccaagtccctagccgaaaacgagcagaag
atcgtggacgagctgaaggcggtccagggcaagcccgtggatatcggcggctactacctg
gccgaccaggccaaggtgaccgccgtgatgcgccccagcgccaccctcaacagcctgctg
caggccgccagcgccgcctga

DBGET integrated database retrieval system