KEGG   Azospira oryzae: Dsui_3444Help
Entry
Dsui_3444         CDS       T01657                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
dsu  Azospira oryzae
Pathway
dsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01130  Biosynthesis of antibiotics
dsu01230  Biosynthesis of amino acids
dsu02024  Quorum sensing
Module
dsu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dsui_3444
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dsui_3444
Enzymes [BR:dsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Dsui_3444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AEV27773
UniProt: G8QKN4
LinkDB All DBs
Position
3702296..3703393
Genome map
AA seq 365 aa AA seqDB search
MTSLKAASHATKPVTDDVRIREIKELVPPAHVFREYPVSNRAAQTTYGARQGIHRILHGA
DDRLLVVIGPCSIHDYEAAMEYAQRLQKEAERLKDDLLVVMRVYFEKPRTTVGWKGLIND
PRMDGSFRINEGLRLARKILLDINELGLSCATEFLDTISPQYTADLIAWGAIGARTTESQ
VHRELASGLSCPVGFKNGTDGNVRIAVDAIRSASAPHHFLSVTKGGHSAIVSTAGNEDCH
VILRGGKGPNYDAASVDAACKDIAAAGLAARLMVDFSHANSSKKFERQVDVAKDVATQLA
AGDERIIGVMVESHLVEGRQDITPDKPLEYGKSVTDACIGWEDSVRVLDILARAVRERRL
VEATE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccctgaaagccgcctcccacgccaccaaacccgtcaccgacgatgtacgcatt
cgcgagatcaaggaactggtgccgccggcccacgtcttccgcgaatatccggtgagcaac
cgggcggcccagaccacctacggcgcccgccagggcatccaccgcatcctgcacggcgcc
gacgaccggctgctggtggtgatcggcccctgctccatccacgactacgaagccgccatg
gagtacgcccagcgcctgcagaaggaagccgagcgcctcaaggacgacctgctggtggtg
atgcgcgtctatttcgaaaagccccgcaccaccgtgggctggaagggcctcatcaacgat
ccgcgcatggacggctccttccgcatcaacgaaggcctgcgcctggcgcgcaagatcctg
ctcgacatcaacgagctgggcctctcctgcgccaccgaattcctcgacaccatcagcccc
cagtacacagcggacctgatcgcctggggcgccatcggcgcccgcaccaccgaatcccag
gtgcaccgggagctggcctccggcctctcctgccccgtgggcttcaagaacggcaccgac
ggcaacgtgcgcatcgccgtggacgccatccgctccgcctccgccccccaccatttcctc
tcggtgaccaagggcggccactcggccatcgtctccaccgccggtaacgaggactgccac
gtcatcctgcgcggcggcaagggccccaactacgatgcggccagcgtggatgcggcctgc
aaggacatcgccgcggccggcctggcagcccgcctgatggtggatttctcccacgccaac
agcagcaagaagttcgagcgccaggtggacgtggccaaggacgtggccacccagcttgcc
gccggcgacgagcgcatcatcggcgtcatggtcgaatcccacctggtggaaggccgccag
gacatcaccccggacaagcccctggaatacggcaagagcgtcaccgacgcctgcatcggc
tgggaagactcggtgcgggtgctggacatcctggcccgggcggtgcgtgagcgccgcctg
gtggaagccacggaataa

DBGET integrated database retrieval system