Deinococcus radiopugnans: QR90_08475 Help Entry QR90_08475        CDS       T03508                                  Name (GenBank) hypothetical protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism dsw  Deinococcus radiopugnans Pathway dsw00362   Benzoate degradation dsw01100   Metabolic pathways dsw01120   Microbial metabolism in diverse environments dsw01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:dsw00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     QR90_08475    00622 Xylene degradation     QR90_08475    00621 Dioxin degradation     QR90_08475 Enzymes [BR:dsw01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      QR90_08475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Motif Other DBs NCBI-ProteinID:  AIZ45130 UniProt:  A0A0A7KGA1 LinkDB All DBs Position 1772207..1772416 Genome browser AA seq 69 aa AA seqDB search MELAKRPQQQRDAIIEGITRVLVENGAHTEGVQVLLYELEMDVWGQGGVTYTERLRRREA AQANETAGS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtggaactggcaaaacgtccgcagcagcagcgggacgccattatcgagggcatcactcgc gtgctcgtcgaaaacggcgcccataccgagggggtccaggtgctcctgtacgaactggaa atggacgtctggggtcagggcggcgtgacctacaccgagcggctccgccgacgcgaagcc gcccaggccaacgagacggccgggagctga

DBGET integrated database retrieval system