KEGG   Deinococcus swuensis: QR90_09320Help
Entry
QR90_09320        CDS       T03508                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dsw  Deinococcus swuensis
Pathway
dsw00620  Pyruvate metabolism
dsw00680  Methane metabolism
dsw01100  Metabolic pathways
dsw01120  Microbial metabolism in diverse environments
dsw01200  Carbon metabolism
Module
dsw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dsw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    QR90_09320
  Energy metabolism
   00680 Methane metabolism
    QR90_09320
Enzymes [BR:dsw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     QR90_09320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIZ45253
UniProt: A0A0A7KL00
LinkDB All DBs
Position
1997874..2000348
Genome map
AA seq 824 aa AA seqDB search
MGIKSDVNLLGRTLGQVLKEQEGEAFFELVERTRALVREVRAGGDDAELRGMLAGLSGED
AGRLARAFTWYFQLVNLAEEYERVRVLRAGEGVRSQSLEGALAALKEQGLSAAQVEALIE
RVNLGLTFTAHPTEMRRRTIRQHLEAVAHDLPQLDDPEAQERVAAHVEAMWSTPELRHLK
PTVLDEVKGGLNYLGAIAGALPGLQRDLNRAFVNVYGQASDARIPLSFSSWMGGDRDGNP
FVTPEATRETLELHRQRARDLLLGSLKQAYADLSQEQEGRDAYRTELRALHNAVRDGERV
EVLPRLEALDTRLRADGQRRTANRLLTPLLTLARVFGQHLVSLDVREHSGQTGAAVAALL
AQAGVEADYLALPEAERQALLAAELRSRRPLWPAGEPLTPELETVIGPIREVRDAIALSG
PRAFGRYVISMAESVSDVLEPLLLAREVGLRVLPVPLFETLDDLYRAPQIMTDLLARPEY
RAILGDDVQEIMLGYSDSNKDAGFLAANWALHEAQRQISAVCRAAGVRWRFFHGRGTSIG
RGGGPASRAILGQPAGTIDAGLRITEQGEALADKYSHPVLAQRNLEQALYGLLLSAARPA
DSLKEEWTAAMDRAAAASAAAYRALVHDDGFLPFFEAVTPIHEIARLNIASRPVRRPGAP
TLSNLRAIPWVMSWTQIRSNLPGWYGLREGLQSIGTEAAQEMYAAWPFFRTVLDNAQMSL
AKSDPLIFEEYLRLLGPHPLAGHLEAAFRETVALVEAVVGAPLLANEPRLRESISLRNPY
IDPIHRIQVELLRRARAEDGGLDTFERPLMLSLQGIAAGVRNTG
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcaagagtgacgtgaatctgctgggccgcacgctgggccaggtgttgaaagaa
caggagggcgaggcctttttcgagctggtggagcgcacccgcgccctggtccgcgaggtc
cgcgccgggggcgacgacgccgaactgcgcggtatgctcgctggcctctccggcgaggac
gcgggacggctggcgcgggccttcacgtggtacttccagctggtcaacctggccgaggaa
tacgagcgggtgcgcgtgctgcgggcgggcgagggcgtgcgctcgcagagcctggagggg
gcgctggccgccctcaaggagcagggattgagcgcggcgcaggtggaggccctgatcgag
cgcgtcaacctgggcctgaccttcacggcccatcccaccgagatgcgccgccgcaccatc
cgccagcacctggaggccgtggcgcatgacctgcctcaactggacgatccggaagcgcag
gaacgggtggccgcccacgtggaggcgatgtggtccacgcccgaactgcggcacctcaag
cccaccgtgctggacgaggtcaagggcggcctgaactacctgggggcgattgccggggcg
ctgccgggactgcaacgtgacctgaaccgggccttcgtgaacgtctacgggcaggcgtcg
gacgccagaattcccctgagtttctcgtcgtggatgggcggggaccgcgacggcaacccc
ttcgtgacgccggaggccacccgcgagaccctggaactgcaccgccagcgggcacgcgac
ctgctgctgggcagcctgaagcaggcctacgccgatctgtcgcaggagcaggagggccgc
gacgcctaccgcaccgagctgcgcgccctgcacaacgccgtgcgtgacggcgagcgggtg
gaggtgctgccgcgcctggaagccctggacacccggctgcgggcggatgggcagcgccgc
accgccaaccggttgctgacgccgctgctgacgctggcgcgggtgttcgggcagcatctg
gtcagcctggacgtgcgcgaacactcggggcagaccggggcggcggtggccgcgttgctg
gcccaggccggggtggaggcggactatctggcgctgcctgaagcggaacggcaggcgctg
ctggccgccgaactgcgctcgcgccgcccgctgtggcctgccggagagccgctgaccccc
gaactggagacggtgatcggccccatccgcgaggtgcgggacgccatcgccctgagcggg
ccacgcgccttcgggcgctacgtgatcagcatggccgagagcgtcagcgacgtgctggag
ccgcttctgctggcccgcgaggtggggctgcgggtgctgcccgtgccgctgttcgagacc
ctggacgacctgtaccgcgcgcctcagatcatgaccgacctgctggcccggcccgagtac
cgcgcgattctgggcgacgacgtgcaggaaatcatgctgggttactcggacagcaacaag
gacgccggctttctggccgccaactgggcgctgcacgaggcacagcggcagatcagcgcc
gtgtgccgggcggcgggcgtgcgctggcgcttcttccacgggcgcggcaccagcatcgga
cgcggcggcggccccgcctcacgcgccattctggggcagcccgccggaaccattgacgcg
ggcctgcgcatcaccgagcagggcgaggcgctggcggacaagtacagccacccggtgctg
gcgcagcgcaatctggaacaggcgctgtacggcctgctgctgtcggccgcgcgcccggca
gattcgctgaaggaggaatggacggcggcgatggaccgcgccgccgccgccagcgccgcc
gcataccgcgcgctggtacacgacgacggtttcctccccttcttcgaggcggtcacgccg
atccacgagatcgcccggctgaacatcgcctcacgccccgttcggcggcccggcgcgccc
accctgagcaatctgcgggccattccctgggtgatgagctggacgcagatccgcagcaac
ctccccggctggtacggcctgcgcgaggggttacagagcattggcacggaggcggcgcag
gagatgtacgcggcgtggccttttttccgcacggtgctcgacaacgcgcagatgagcctg
gccaagagtgaccccttgatcttcgaggaatacctgcgcctgctggggccgcacccgctg
gccggacatctggaggccgccttccgcgagaccgtggcgctggtagaggctgtggtgggc
gcgccgctgctggccaatgaaccgagattgcgcgagagcatcagcctgcgcaacccgtac
attgatccgattcaccgcattcaggtggagttgctgcgccgcgcccgcgccgaggacggc
ggcctggacaccttcgagcgcccgctgatgctgagcctgcaaggcattgctgcgggggta
cggaacacggggtaa

DBGET integrated database retrieval system