KEGG   Deinococcus swuensis: QR90_14795Help
Entry
QR90_14795        CDS       T03508                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
dsw  Deinococcus swuensis
Pathway
dsw00020  Citrate cycle (TCA cycle)
dsw00270  Cysteine and methionine metabolism
dsw00620  Pyruvate metabolism
dsw00630  Glyoxylate and dicarboxylate metabolism
dsw00680  Methane metabolism
dsw01100  Metabolic pathways
dsw01110  Biosynthesis of secondary metabolites
dsw01120  Microbial metabolism in diverse environments
dsw01130  Biosynthesis of antibiotics
dsw01200  Carbon metabolism
Module
dsw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dsw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dsw_M00012  Glyoxylate cycle
dsw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dsw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    QR90_14795
   00620 Pyruvate metabolism
    QR90_14795
   00630 Glyoxylate and dicarboxylate metabolism
    QR90_14795
  Energy metabolism
   00680 Methane metabolism
    QR90_14795
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    QR90_14795
Enzymes [BR:dsw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     QR90_14795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AIZ46715
UniProt: A0A0A7KKU3
LinkDB All DBs
Position
complement(3163205..3164197)
Genome map
AA seq 330 aa AA seqDB search
MSGKQPVRVAVTGAAGQIGYSLLFRIASGDMLGKDQPVILQLLEVTPALKALQGVVMELR
DCAFPLLADIVTSDDANVAFKDADYALLVGAMPRKAGMERGDLLSANGGIFKPQGEALNK
VASRDVKVLVVGNPANTNALIAQQNAPDLNPGQFTAMVRLDHNRAVSQLAEKTGKPVTSI
QNLTIWGNHSSTQYPDLSAATVDGQPALELVDREWYETQYIPTVAKRGAAIIEARGASSA
ASAASAAIDHMRDWALGTPEGQWVSMGIPSDGSYGVPEGLIYGFPVKCSGGKYEIVQGLD
VSDFSRGKMDATAQELQEERDEVRKLGLVK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcaaacaacccgtccgtgtggccgtgaccggtgcggctggtcagatcggctac
agcctgctgtttcgtatcgcgtccggcgacatgctgggcaaggatcagccggtcatcctg
caactgctggaagtgaccccggccctcaaggcgctgcagggcgtcgtgatggagctgcgc
gactgcgccttcccgctgctggcggacatcgtgaccagcgacgatgcgaatgtggccttc
aaggacgccgactacgccctgctggtgggcgcgatgccgcgcaaggccggcatggaacgc
ggtgacctgctgtcggccaacggcggcatcttcaagccgcagggcgaggcgctgaacaaa
gtcgccagccgcgacgtcaaggtgctggtggtgggcaaccccgccaacaccaacgccctg
atcgcccagcagaacgcccccgatctgaaccccggacagttcacggcgatggtgcggctg
gatcacaaccgcgccgtgtcgcagctggccgagaagaccggcaagcccgtcacctctatc
cagaacctgaccatctggggcaaccactccagcacccagtacccggatctgagcgcggcc
accgtggacggccagcccgccctggagctggtggaccgcgagtggtacgaaacccagtac
atccccaccgtcgccaagcgcggcgcggccatcatcgaggcgcgcggggccagcagcgcc
gcgagtgccgctagcgcggcgattgaccacatgcgcgactgggcgctgggcaccccggaa
ggccagtgggtcagcatgggcattcccagcgatggcagctacggcgtgcccgaaggcctg
atctacggtttcccggtcaagtgcagcggcggcaaatacgagatcgtgcagggcctggac
gtctccgacttcagccggggcaagatggacgccaccgcccaggagctgcaggaggagcgc
gacgaggttcgcaagctgggtctggtcaagtaa

DBGET integrated database retrieval system