KEGG   Desulfitobacterium hafniense Y51: DSY1102Help
Entry
DSY1102           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00010  Glycolysis / Gluconeogenesis
dsy00053  Ascorbate and aldarate metabolism
dsy00071  Fatty acid degradation
dsy00280  Valine, leucine and isoleucine degradation
dsy00310  Lysine degradation
dsy00330  Arginine and proline metabolism
dsy00340  Histidine metabolism
dsy00380  Tryptophan metabolism
dsy00410  beta-Alanine metabolism
dsy00561  Glycerolipid metabolism
dsy00620  Pyruvate metabolism
dsy00625  Chloroalkane and chloroalkene degradation
dsy01100  Metabolic pathways
dsy01110  Biosynthesis of secondary metabolites
dsy01120  Microbial metabolism in diverse environments
dsy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSY1102
   00053 Ascorbate and aldarate metabolism
    DSY1102
   00620 Pyruvate metabolism
    DSY1102
  Lipid metabolism
   00071 Fatty acid degradation
    DSY1102
   00561 Glycerolipid metabolism
    DSY1102
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DSY1102
   00310 Lysine degradation
    DSY1102
   00330 Arginine and proline metabolism
    DSY1102
   00340 Histidine metabolism
    DSY1102
   00380 Tryptophan metabolism
    DSY1102
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DSY1102
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DSY1102
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DSY1102
Enzymes [BR:dsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     DSY1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAE82891
UniProt: Q24YK1
LinkDB All DBs
Position
1313302..1314672
Genome map
AA seq 456 aa AA seqDB search
MPDIKEILVKQRAFFQTGKTKELQFRVDMLNKLRSAIKIHEEEIMAALKADLNKAPFEAY
ATEVGMVLEELNYTLKHISSWVKPKRVRTPLVHFPSASYLYTEPYGSVLIMSPWNYPFQL
TLAPLVGAISAGNCAVLKPSEYSANTSAMIERIVKEIFDESFVAVVRGGREANKTLLNEK
FDYIFFTGSIQVGKTVMESAARHLTPVTLELGGKSPCIVDDTADLELAAKRIVWGKFLNA
GQTCVAPDYLLVHRTVKEKIIQEIKKSITAFYGHDPLGNEDYPKIINQKHFERLLGLLKS
GRVIEGGRSEEKTRRIAPTILDDVTWESPVMKEEIFGPLLPVLEFESFETALSTVNQHPK
PLALYLFTRSKVHEAQAIAKTSFGGGCINDTIIHLANPNLRFGGVGESGMGQYHGKGSYD
TFSHTKSIMKKSNMLDIPLRYPPFKNHLSLLKKLMK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgccggatataaaagaaattttggtcaaacaaagggctttttttcagaccgggaaaacc
aaagagctacagtttcgggtggatatgctgaataaattgcggtcagccataaaaatccat
gaggaggagattatggcggctttgaaagctgatctgaataaagcgccttttgaagcctat
gccacagaagtgggcatggtactggaggaactcaactatacgcttaaacatatctcaagc
tgggtcaaacctaaacgtgtacggactcctctggtgcactttccttccgccagctatctt
tatacagagccctacggctccgttctgattatgtcaccctggaattatccctttcagctg
accctggctcctttggtgggggccataagtgcaggaaactgcgcggtactcaagccatcg
gagtattcggccaacacttccgcaatgatcgagaggatagtgaaggaaatttttgacgag
tcctttgtggccgtggtgcgcggaggccgagaggccaacaaaaccctgctcaatgaaaaa
tttgattatatctttttcaccggcagcatccaggtgggaaaaacggtgatggaatccgcc
gccagacacctgactccggtaactctggaattgggggggaaaagcccctgtattgtcgat
gacactgccgatcttgaattggcggccaaaagaatcgtctggggaaaatttctgaatgcg
ggacagacctgcgttgccccggattatttgctagtgcataggactgtcaaggaaaagatc
atccaggagatcaaaaaatccatcactgccttttatggccatgatcctttaggcaacgag
gactatcctaaaatcatcaatcagaagcatttcgagcggcttttaggcttgctgaagagc
gggcgggttatagagggaggaaggtccgaagagaaaaccaggcggattgcgcccaccatt
ttagatgatgtaacctgggaaagcccagtgatgaaggaagaaatctttggccccctgctg
ccggtgttggaatttgagagttttgagactgccctatctacggttaatcaacaccccaag
ccgttggctttgtatctgttcaccagaagtaaggtgcatgaagcccaagccatcgctaaa
acgtcctttggcggtggatgcatcaatgatacgattatacatctggctaaccccaatttg
cgcttcggaggtgtgggggagagcggcatgggccaatatcatggcaaaggaagctatgac
accttttcccatacgaaaagcattatgaagaaatccaatatgctggatattccgctccgg
tatccgccttttaaaaatcatttgtccctgcttaagaagcttatgaaataa

DBGET integrated database retrieval system