KEGG   Desulfitobacterium hafniense Y51: DSY3226Help
Entry
DSY3226           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
Organism
dsy  Desulfitobacterium hafniense Y51
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal Protoglobin DUF948 Syntaxin_2 BLOC1_2 Ribonucleas_3_2 Med9 VirionAssem_T7 IFT57 Nup54 Seryl_tRNA_N
Motif
Other DBs
NCBI-ProteinID: BAE85015
UniProt: Q24SH7
LinkDB All DBs
Position
complement(3651779..3653026)
Genome map
AA seq 415 aa AA seqDB search
MINLHQFDLNESIKLLKLEQDQLLLLKEFKPVMEQDVDQIVDQFYAHITKISQLNGIIKE
FSSVERLRGLQRNYLLSIFPDVIDEGYIMSRIRIGDVHKRINLPPFVYLSSYQTFFDLIL
PRIFAHYRKKPEQALRLSLAVLRIFSFDQQVVMASYIQSYIADLDKKEELEKAYEEIDVL
QHRVSEASQALAATSEQTAASAAQMHEATELISQNAGDAADFSRKVDNLAQDGAQKIQQI
SERILGLAGMSEKMQEKMAELDRSSARIANITDVIKEIASQTNLLALNAAIEAARAGESG
RGFGVVAEEVKKLANNSEQSVKEISTMIAVTRQNTTAVSKVIEDTTKAMHEAASEAQEVV
ARFGDIMSAIQSSIQQVREIATQIDALTMTAGQIGAASEDVANSATSLAQMGLRE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgattaacctccatcaatttgacctgaatgagtctataaagcttttaaaattagagcag
gaccaattgctgctgctgaaagaatttaagcctgttatggagcaggatgtggatcaaatc
gttgatcagttctatgctcatattacgaagatttctcaactgaacgggataatcaaggag
ttttcttctgtagagcggctcagaggtttgcagagaaattatctactctcgatttttccc
gatgtcatcgacgaagggtatattatgagccggatcaggattggggatgtacataagcgt
attaatctgccgccctttgtttatttaagctcttatcaaaccttctttgacttgattttg
ccaagaatttttgcccattatcgaaagaagccggagcaggctttgcggttaagccttgcc
gtactgcggatcttcagctttgatcagcaagtggtgatggccagttatatccagtcctat
atagcggatcttgataagaaagaggagctggaaaaagcctacgaggagattgacgttttg
cagcaccgggtcagtgaagccagccaggccctggcagcgacttcggaacagaccgctgct
tcggcggctcagatgcatgaggcgactgagctcatctcgcaaaatgccggtgatgcggca
gatttttctcgtaaagtggataacctggctcaggacggggcccagaagattcaacagatt
tccgagcgtatcttagggctggcagggatgtcggaaaaaatgcaggaaaagatggcggag
cttgatcgcagttcggcccggatcgccaatattacggatgtcattaaagaaatcgcttct
cagaccaaccttttggcccttaatgcggccattgaagccgcccgggccggggagtccggc
agagggttcggggtggtggcggaggaagtgaagaaactcgccaataattctgagcaatcg
gttaaggaaatcagcactatgattgcagtaacccggcaaaatactacggccgtgagcaag
gtgattgaagatacgaccaaggcgatgcatgaagcggcatctgaagcgcaggaagtggtc
gcccgctttggggacattatgagcgctattcaatccagtattcagcaggttcgtgagatc
gctacccagatcgacgctctgaccatgacggccggccagattggggctgcttccgaagat
gtggccaattcagcaacatcactggcccagatgggattaagggagtaa

DBGET integrated database retrieval system