KEGG   Desulfitobacterium hafniense Y51: DSY4022Help
Entry
DSY4022           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00473  D-Alanine metabolism
dsy01100  Metabolic pathways
dsy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dsy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DSY4022
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    DSY4022
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dsy01011]
    DSY4022
Enzymes [BR:dsy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DSY4022
Peptidoglycan biosynthesis and degradation proteins [BR:dsy01011]
 Precursor biosynthesis
  Racemase
   DSY4022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAE85811
UniProt: Q24Q81
LinkDB All DBs
Position
complement(4592335..4593447)
Genome map
AA seq 370 aa AA seqDB search
MENRRPVWTEINLQALQRNYDRIQALTESEIMPIVKADAYGHGALQAVEAFYERGARRFG
VALLNEALELRRAYPDIKVMLIGSLPEESIETVVKEDIICGVYQLDQAVILAKEAERQGK
KAVIHLKVDTGMGRIGFREEDWEELFGCTKLPGLYIEGIYTHFATADHSDLRFAREQLRK
FLVMCDKIKAQGIHIPIRHAANSGALLQLPEAHLDMVRPGIILYGLPPSQHVGNDLGLEP
VLSWKAKISHIKVVPQGETISYGRTFRTAYPTRVATIPLGYADGLRRNLSNKGEVLIKGR
RTTMIGRVCMDQTMLDVTKIPEVQVGDVVTLLGMDGYERIDATEMAGWLDTINYEIVCGI
SKRVPRVYIK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatagacgaccggtttggacagaaatcaacttacaagcgctgcagaggaattat
gaccggattcaggccttgactgaaagtgaaatcatgcccatagtcaaagctgatgcatac
ggacatggagccttacaagcagtagaagcattttatgaaagaggtgcccgtcgtttcgga
gttgccttattgaatgaagctttggagcttagaagagcgtatccggatatcaaagtcatg
ctcatcggttctttacccgaagaatccatagagacagttgttaaagaagatattatttgc
ggggtgtatcagttagatcaagcagtaattttagcgaaagaagcagagagacagggcaag
aaggcagtaattcatcttaaagtggatacaggaatggggcgcattggcttcagagaagag
gattgggaagaacttttcggctgtaccaagctgcctggtctttacatagagggaatttat
actcattttgccacggcggatcatagtgatctgaggtttgcccgggagcaactgaggaaa
tttttagtgatgtgtgataaaatcaaagcccagggaattcatatccctatccggcatgcg
gccaacagcggagctctgctgcagctgccggaggctcatctggacatggtgcggccgggg
attattctctatggacttcctccctcccagcatgtgggcaatgatttaggtttggagccc
gtactttcctggaaagccaagatcagccatatcaaggtggtcccccaaggggaaaccatc
agctatggcagaaccttcagaaccgcctatcccacccgggtggcgacgattcccctcggt
tatgccgatggtctgcgccggaatctatccaataagggtgaagttttaattaaaggcaga
agaaccaccatgattgggagagtctgtatggatcagaccatgctggatgtcacgaaaata
ccggaggtgcaggtaggggatgtggttaccctactcggcatggatggttatgaacggatc
gatgccacggaaatggccggttggttggatacgataaattatgagattgtctgtggaata
tcgaagcgggttccacgggtgtatattaaataa

DBGET integrated database retrieval system