KEGG   Desulfitobacterium hafniense Y51: DSY4956
Entry
DSY4956           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00300  Lysine biosynthesis
dsy01100  Metabolic pathways
dsy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    DSY4956
Enzymes [BR:dsy01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     DSY4956
SSDB
Motif
Pfam: NAD_binding_7 AlaDh_PNT_C 2-Hacid_dh_C HI0933_like FAD_binding_3 Pyr_redox_2 3HCDH_N
Other DBs
NCBI-ProteinID: BAE86745
UniProt: Q24MJ7
LinkDB
Position
complement(5625343..5626182)
AA seq 279 aa
MTRLQVRDIESILRQMNIYDAELLAKTGYRLAHIAAHAVGRLSADIPDPGLIAVVPMTCG
LGVISGFAETVAGILGFLGMRAFVPVSPDVKGFAEALERGAEIIFMADEERFIGVHLKTG
QISDNSEATGRGFAAALDCLTGGLKERDVLVIGTGPVGRAAAFAVLDFGGHVHVLDKELT
VSEKLAQDILCQRSCSIGIERELDSAMHKHRAIVVACPEGGLIRADHLHTDTCIAAPGVP
LGIQAQAIKKVEGRLVHDPLQLGVATMLYEILAKISPPA
NT seq 840 nt   +upstreamnt  +downstreamnt
atgactcgtcttcaggtaagggatatcgaatcaatcctccggcagatgaacatatatgat
gcggaactattggccaaaaccgggtataggcttgcccatattgccgcccatgccgttggc
aggctttcggcagatattcctgatccggggttaattgccgtagtgccgatgacctgcggc
ctgggtgtgatcagtggttttgcggagacggttgccggaattctgggtttcctgggcatg
agggcctttgtgccggtctctcccgatgtcaagggattcgctgaagcgctggaacgcgga
gcggaaattatctttatggccgatgaagagcgttttattggggtccatttgaaaacgggg
cagatctcggacaacagcgaggcaacaggccggggctttgcggctgctcttgattgcttg
accggcggccttaaagagcgggatgttctggtcataggcaccggtccggtggggcgggct
gccgctttcgccgtccttgatttcgggggccatgtccatgtccttgataaggagttgacc
gtgagcgaaaaattagctcaggacatcctctgtcaacgcagctgctctattggcattgag
agggaattggattcggcgatgcacaagcatcgggccattgtggtggcctgtcctgaaggg
ggattgatcagagcggatcatcttcatacggatacctgcatagctgcgccgggggtgccg
ttgggtattcaggctcaagccatcaagaaggttgaggggcgtttggtgcatgatcctctg
caattaggtgtggcgacaatgctctatgagattcttgccaaaatatcaccgccggcataa

DBGET integrated database retrieval system