KEGG   Desulfurobacterium thermolithotrophum: Dester_0487
Entry
Dester_0487       CDS       T01427                                 

Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00970  Aminoacyl-tRNA biosynthesis
dte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dte00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dester_0487
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dte03029]
    Dester_0487
Enzymes [BR:dte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dester_0487
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dester_0487
Mitochondrial biogenesis [BR:dte03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dester_0487
SSDB
Motif
Pfam: Amidase RDM GAT
Other DBs
NCBI-ProteinID: ADY73140
UniProt: F0S2R8
LinkDB
Position
complement(490863..492326)
AA seq 487 aa
MELINKSLKELNDLIKKKEVKPSEILEELLSRIKETEPKLNAYITVTEEKARKKAEIADR
ELEKLQPDEIPELFGIPLSIKDNINVENVRMTCASKILENFISPYDATVIKRLREKGAIF
VGKNNLDEFAMGSSTETSYFGPTKNPWDLERVPGGSSGGSAAAVSARSAIASLGSDTGGS
IRQPAALCGVVGLKPTYGRVSRYGLTAFASSLDQIGPITKTVEDAAYLMNIISGQDSKDA
TSARLPVPNFLENLNNEIKGLKAGLPKEYFVEGIEPEVKEKVLDVVRKLESLGVEIEEIS
LPNTKYAVETYYIIAPAEASSNLGRFDGVRYTYRAKNYENLIDMYCKTRAEGFGDEVKRR
IMIGTYTLSAGYYDAYYLKAQKVRTLIYQGFEKAFEKVDFIVTPVSPTTAFRLGEKTSDP
IKMYLSDIFTIAVNLAGLPAISIPCGFDSKNLPIGLQIIGKAFDEVTILNVANILEKEIA
LNTIPPV
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggagcttattaataaatcattgaaggagctcaatgatttaataaagaaaaaagaagtt
aagccttcggaaattttagaagagctcctttcaagaataaaggaaactgagcctaaatta
aacgcttatattaccgttacagaagaaaaagctagaaaaaaagcagaaattgcagataga
gaacttgaaaaactacaacctgatgaaattccagaactttttggtattcctctttctata
aaggataacataaacgtagaaaacgtcagaatgacttgcgcttcaaagatattggaaaac
tttatttctccttacgacgcaactgtaataaagagattgagagaaaaaggagctattttt
gttgggaaaaacaatcttgatgagtttgcaatgggttcttcaactgaaacttcttacttt
ggtccgactaaaaacccatgggacttagaaagagttcctggaggttcttctggaggatca
gcagcagctgtctctgcaagatcagctatagcttctcttggttcggatacaggaggttca
attagacagccagctgctctttgtggtgttgtaggtcttaaacctacttacggaagagta
tcaaggtatggtcttacagcctttgcttcttctcttgatcagattggtccaataacaaaa
actgtagaagatgctgcttaccttatgaacataatatcaggacaagattcaaaagatgct
acaagtgcacggcttcctgttccaaacttcttagaaaatttaaacaatgaaataaaaggt
cttaaagcgggacttccaaaggaatattttgtagaaggaattgagcctgaggttaaagaa
aaagttttagatgttgttagaaaattagaatctcttggagttgaaatagaagaaatatcc
cttccaaatacaaagtatgcagttgaaacttactacatcattgctcctgctgaagcttct
tcaaacttaggaagatttgacggtgtcagatatacctatagagcaaaaaattacgaaaac
ttgattgatatgtactgtaaaacaagagcagaaggttttggagatgaagtaaaaagaaga
ataatgattggaacgtacactttaagtgcaggatattatgatgcctattatctaaaagct
caaaaagttagaactctgatctatcaaggatttgagaaagcctttgaaaaagttgacttt
atcgtaacacctgtttcacccacaacagcctttaggcttggcgagaaaacaagcgatcca
ataaaaatgtatctttcagatatttttacaattgcagtaaatcttgcaggacttcctgct
atttctattccttgtggatttgacagtaaaaaccttccaataggccttcagataattgga
aaagcttttgatgaggtaacaatactcaatgttgcaaatatcttagaaaaagaaattgca
ttaaatacaataccacctgtgtag

DBGET integrated database retrieval system