KEGG   Desulfurobacterium thermolithotrophum: Dester_0488
Entry
Dester_0488       CDS       T01427                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00970  Aminoacyl-tRNA biosynthesis
dte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dte00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dester_0488
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dte03029]
    Dester_0488
Enzymes [BR:dte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dester_0488
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dester_0488
Mitochondrial biogenesis [BR:dte03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dester_0488
SSDB
Motif
Pfam: Glu-tRNAGln DUF3616
Other DBs
NCBI-ProteinID: ADY73141
UniProt: F0S2R9
LinkDB
Position
complement(492345..492635)
AA seq 96 aa
MKLSKEEVKHIAMLSRLNLEEGEIEKFQVQLSEILNFVEKLNELDTEGIDPKFQIIPPQN
VLREDLPGVSLSGEKVFMNAPETDGQYFIVPKVVKK
NT seq 291 nt   +upstreamnt  +downstreamnt
atgaagctatcaaaggaagaagtaaaacacatagcaatgctttcaagacttaacttagaa
gaaggggaaattgaaaagtttcaagttcagctaagtgaaattcttaactttgttgaaaaa
ttaaacgagctggatacggaaggtattgatccaaagtttcaaattatcccacctcaaaat
gttttaagagaagatttgcccggtgtaagtctctcaggagaaaaagtatttatgaatgca
cctgaaacagatggacagtatttcatagttccaaaagttgttaagaaataa

DBGET integrated database retrieval system