KEGG   Desulfurobacterium thermolithotrophum: Dester_0854Help
Entry
Dester_0854       CDS       T01427                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dte  Desulfurobacterium thermolithotrophum
Pathway
dte00970  Aminoacyl-tRNA biosynthesis
dte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dte00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dester_0854
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dte03029]
    Dester_0854
Enzymes [BR:dte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dester_0854
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dester_0854
Mitochondrial biogenesis [BR:dte03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dester_0854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ADY73494
UniProt: F0S3S2
LinkDB All DBs
Position
complement(857837..859294)
Genome map
AA seq 485 aa AA seqDB search
MEFEAVIGLEVHAQLLTETKIFCSCKNEFGAPPNTNVCPVCLGIPGSLPVLNKKAVEYAV
KAALALNCKINTYSVFARKHYFYPDLPKAYQITQYELPFAENGWIEIEKPDGTKKKIRIK
RIHMEEDAGKTVHGEGLDRSSYVDLNRAGTPLIEIVSEPDISTPEEARLYMQKLRDILVW
IGVNDGNLEEGSLRCDANVSIRPKSSDKLGTRTEIKNVNSFRFIQKALEYEIERQIKVVK
SGGEVVQETRLFDSQKGITKTMRTKEEAEDYRYFPEPDLPPLIIDDEWLESIKASLPELP
DQVKERFIKDYGITSYDADILVRDRALSQFFEEAAKNYSGEAKKVANIIISDLLGALNEE
KLEISESPVEPRHVAQLLELVDKEVISLRVAKEEIIPEMVKSGKEPKTIVEEKGLVQISD
ESALKEIIKKVLGNNEKAVKQYKEGNDKQKQKAVKFLIGQVMKETRGKANPKLLNQLIPQ
VLEEL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgaagcagtaatcgggcttgaggttcacgctcagcttttaacagagacaaaa
attttctgtagctgtaagaatgagtttggagctccaccaaatactaacgtttgtcctgtc
tgtcttggaatacctggatctcttccagttctgaataagaaagctgttgagtatgctgta
aaggcagcacttgctctaaactgtaagattaatacttattctgtttttgcgagaaaacac
tacttttatccagaccttccaaaggcttatcagataacacagtacgagctcccgtttgca
gaaaatggctggatagaaattgaaaaacctgatggaacgaaaaagaagataagaattaaa
agaattcatatggaagaagacgctggaaaaacagttcacggagaaggacttgacaggagc
tcttacgttgacctcaatagagccgggacaccactaattgaaatcgtttcagagcctgat
atctcaactccagaggaagcaaggctttatatgcaaaagctgagggatatcctcgtctgg
atcggtgtaaacgatggaaaccttgaggaaggttcattaagatgtgacgccaacgtttct
attagacctaagagttcagataaacttggaacgagaacagagattaaaaacgttaactct
tttagattcattcaaaaagctcttgagtatgaaatagaaagacaaataaaggttgttaaa
agcggtggagaagtcgttcaggaaacaaggctctttgattcccagaaaggaattacaaag
acaatgagaacgaaagaggaagctgaggactacagatatttccctgaacctgatcttcca
cctctcataatagacgatgaatggcttgaatctataaaagcttctttacctgaacttcca
gaccaggtaaaagaaagatttataaaagattacggtattacatcttacgacgctgatatc
cttgttagagatagggctctttcccagttctttgaagaggcagctaaaaactattctgga
gaagcaaagaaagttgcaaacattatcatttcagaccttcttggagctttaaacgaagaa
aagcttgaaatctcagagtctccagtcgaacctcgccacgttgctcagctccttgagctt
gttgataaagaggtaatatctctaagagtcgcaaaggaagaaatcattcctgaaatggtt
aagagtggaaaagaacctaaaacgatcgttgaagagaaaggacttgttcagatatccgat
gaatcagctctcaaggaaattatcaagaaagtccttggaaacaacgaaaaagcggttaaa
cagtacaaagaaggtaacgacaaacaaaaacaaaaagctgttaaattcttgattggtcag
gtaatgaaggaaacgagaggaaaggcaaatccaaaacttttaaatcagctaatcccacaa
gttcttgaagaactttaa

DBGET integrated database retrieval system