Desulfurobacterium thermolithotrophum: Dester_0998 Help Entry Dester_0998       CDS       T01427                                  Name (GenBank) single-strand binding protein   KO K03111   single-strand DNA-binding protein Organism dte  Desulfurobacterium thermolithotrophum Pathway dte03030   DNA replication dte03430   Mismatch repair dte03440   Homologous recombination Brite KEGG Orthology (KO) [BR:dte00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     Dester_0998    03430 Mismatch repair     Dester_0998    03440 Homologous recombination     Dester_0998  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dte03032]     Dester_0998    03400 DNA repair and recombination proteins [BR:dte03400]     Dester_0998    03029 Mitochondrial biogenesis [BR:dte03029]     Dester_0998 DNA replication proteins [BR:dte03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Dester_0998 DNA repair and recombination proteins [BR:dte03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      Dester_0998   TLS (translesion DNA synthesis) factors    Other SOS response factors     Dester_0998 Mitochondrial biogenesis [BR:dte03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     Dester_0998 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB tRNA_anti-codon Motif Other DBs NCBI-ProteinID:  ADY73637 UniProt:  F0S465 LinkDB All DBs Position complement(997028..997405) Genome browser AA seq 125 aa AA seqDB search MANLNKVFLIGRLVADPQLSHTNTGTPFTRFRIAVNNPYRDRSGNWQEDTLFIDIVLWGD AADRAVSRFSKGSRVLVEGRLRQSNWETEEGEKRSRIEVRADRVVGLDPRREQNETLDEI DDIEF NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggctaacctcaataaagtatttcttattggaagattagttgctgatcctcaactatct catactaatactggaacgccttttacaaggtttagaatagcagttaataatccctataga gacagaagtggtaattggcaggaagatacgctatttattgacattgttttgtggggagat gcagctgacagagctgtaagtagattcagtaagggatctagagtccttgtagaaggaaga ttaagacaatctaactgggaaacagaagaaggtgaaaaacgttcaagaattgaagtaaga gcagatagagtagttggacttgatcccagaagagaacaaaacgaaaccttagatgaaatc gacgatattgaattttaa

DBGET integrated database retrieval system