KEGG   Dictyoglomus thermophilum: DICTH_0803Help
Entry
DICTH_0803        CDS       T00774                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00473  D-Alanine metabolism
dth00550  Peptidoglycan biosynthesis
dth01100  Metabolic pathways
dth01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dth00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DICTH_0803
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DICTH_0803
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    DICTH_0803
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dth01011]
    DICTH_0803
Enzymes [BR:dth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DICTH_0803
Peptidoglycan biosynthesis and degradation proteins [BR:dth01011]
 Precursor biosynthesis
  Amino acid ligase
   DICTH_0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK CPSase_L_D2 GARS_A ATP-grasp_4 TTL ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACI18497
UniProt: B5YDR1
LinkDB All DBs
Position
complement(809763..810698)
Genome map
AA seq 311 aa AA seqDB search
MKIGVLIGVKSSEKEIAFKTARNIVNALKLKGYDYIEIPIDENVVENIKKANINVAIISA
HGKYGEDGTIQGLLELLGIPYVGSGVLASALALDKTMAKKIFTFHNIPTPKWIELSKKEL
ETKDLNNIVKNVSKLKKPWIIKPATQGSTIGLSLASTEEELLKGIELAFKYDENIIIEEY
IKGKEITAGIYDINNPVCLPLIEIIPKTGFYDYETKYTPGLSDHIIPARLPKEVYEKAQG
LGILAHQALGCRHLSRVDMIVEENTNHIYVLEVNTIPGMTETSLYPEAAKAFGIDFPELI
DSFIKATLKNI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggtgttcttatcggtgtaaaatcaagtgaaaaagagattgcttttaaaaca
gctcgaaacattgtaaatgctttaaagttaaaaggttacgattacattgagattcccatt
gatgaaaatgtagtagagaacattaaaaaagcaaatataaatgtagccattatatctgcc
catggaaaatatggagaagatggaaccattcaaggattactcgagcttcttggtattcca
tatgtaggatctggagtccttgcaagtgcccttgcccttgacaaaacaatggcaaaaaaa
atatttacctttcacaatattccaactcctaaatggatagaattatctaaaaaggagctt
gaaacaaaagatttaaataatattgtaaaaaatgtatcaaaattaaaaaaaccttggatc
ataaagcctgcaactcaaggatctactattgggctttcattagcaagcacagaagaagaa
ctattaaaaggtatagaattggcttttaaatatgatgaaaatataatcatcgaggaatat
ataaagggaaaagagattacagcaggaatctacgatattaataatcctgtatgtttaccc
cttatagagattatacctaaaacaggcttttatgattatgaaactaaatatactccagga
ctctcagatcatattattcctgcgagacttcccaaagaagtatacgaaaaagcccaaggg
cttggtattttagctcaccaagcccttgggtgcagacatctatcaagagttgatatgatc
gtagaggaaaatacaaaccatatctatgtattagaagttaacactattcctggaatgacc
gagacaagtctatatccagaagccgcaaaagcctttggtatagactttcctgaacttata
gatagttttataaaagcaacccttaaaaacatataa

DBGET integrated database retrieval system