KEGG   Dictyoglomus thermophilum: DICTH_1985Help
Entry
DICTH_1985        CDS       T00774                                 

Definition
(GenBank) pyruvate synthase subunit PorA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00010  Glycolysis / Gluconeogenesis
dth00020  Citrate cycle (TCA cycle)
dth00620  Pyruvate metabolism
dth00633  Nitrotoluene degradation
dth00640  Propanoate metabolism
dth00650  Butanoate metabolism
dth00680  Methane metabolism
dth01100  Metabolic pathways
dth01110  Biosynthesis of secondary metabolites
dth01120  Microbial metabolism in diverse environments
dth01130  Biosynthesis of antibiotics
dth01200  Carbon metabolism
Module
dth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICTH_1985
   00020 Citrate cycle (TCA cycle)
    DICTH_1985
   00620 Pyruvate metabolism
    DICTH_1985
   00640 Propanoate metabolism
    DICTH_1985
   00650 Butanoate metabolism
    DICTH_1985
  09102 Energy metabolism
   00680 Methane metabolism
    DICTH_1985
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DICTH_1985
Enzymes [BR:dth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DICTH_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DXP_redisom_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ACI19185
UniProt: B5YCD2
LinkDB All DBs
Position
1952656..1953843
Genome map
AA seq 395 aa AA seqDB search
MKTQIKRIAIEGNEAAALAFKQVNPDVVAAYPITPSTEVVQKFSEYVANGEVDTEFVPVE
SEHSAMSACIGAAAAGARVMTATASQGLALMWEMLYIASALRLPIVMSVSNRALSAPINI
HGDHSDAMGARDSGWIQIFSENVQEIYDNIFQAVKIAEHPDVRLPVMVGYDGFITSHSEE
MIEILEDDVVRNFIGKYKPKYTLLDVDNPIAVGPLALTDSYFEFKVAQAYALENSLPIIK
QVGKEYGDLTGRYYDVIERYRTEGAEYIIVAMSSTVGTAREVVDTLREKGLPVGLLKIRV
FRPFPTEDIINALKDAKVIGILDRSMVPGSFGGPLYHEITSAFYHYEKRPIAQAYVYGLG
GRDITTQHIEKVFEELIDIGKKGKPNPLTYIGVRE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcaaattaaaagaattgctatagaaggtaatgaggcagcagcattagccttt
aagcaagtaaatcctgatgtagttgctgcctatcctataacaccttctactgaggtagtt
cagaaattctctgaatatgtagccaatggagaggtagatacagaatttgtacccgtagag
agtgaacacagcgccatgagtgcatgtattggtgctgctgccgcaggagcaagagtaatg
actgctacagcctcccaaggacttgctttaatgtgggagatgctttatattgcatcagcc
ctcagactccctatcgttatgtccgtatcaaacagagctttatctgctccaataaatatt
catggagatcatagcgatgctatgggagcaagagattctggctggatacaaatcttttct
gaaaatgtgcaagaaatatatgataatatctttcaagcagtaaaaattgcagaacatccc
gatgtaagacttcctgtaatggtaggatacgatggattcatcacaagccattcagaagag
atgatagaaatactcgaagacgatgtagtaagaaatttcataggcaaatataaaccaaaa
tacaccttgctcgatgtagataatcctatagccgttggtcccctcgctctaaccgattcc
tattttgagttcaaagtagcacaggcttatgcccttgaaaattctcttccaattataaaa
caggtaggcaaggaatacggtgatcttacaggaagatattatgatgtaatagaaagatac
agaactgaaggagcagaatatatcatagttgctatgagctctacagtggggaccgcaaga
gaagtggtcgataccctaagagaaaagggacttcctgtgggacttcttaagattagagta
tttagaccattccctaccgaggatattataaatgctcttaaagatgcaaaagtaatagga
atccttgacagaagcatggtacctggatccttcggcggaccactctatcacgaaattacc
tctgccttctatcattacgaaaaaaggcctatcgctcaagcatatgtgtatggccttgga
ggtagagatatcactactcaacatatagaaaaagtatttgaagagctcatagatataggt
aagaaaggaaagccaaatcctcttacctatatcggagtaagagaatag

DBGET integrated database retrieval system