KEGG   Desulfomonile tiedjei: Desti_0132Help
Entry
Desti_0132        CDS       T02147                                 

Definition
(GenBank) DNA ligase D/DNA polymerase LigD
Organism
dti  Desulfomonile tiedjei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase NRIP1_repr_1
Motif
Other DBs
NCBI-ProteinID: AFM22879
UniProt: I4BZY8
LinkDB All DBs
Position
161857..163467
Genome map
AA seq 536 aa AA seqDB search
MKKRLTSYRDKRDFAKTPEPAGETESNHKVPIFVVQKHDAKKLHYDFRLEVNGVLKSWAV
PKGPSLEPSVKRLAVATEDHPLEYADFEGYIPDGEYGAGPVIVWDRGFYSNITQKRGQAL
SIEQAIEHGHLTVLLDGERLKGAYSLSRIQSGAKAQWLMVKVKDKFAADRDLATEFQDSA
LSGRTLEDISNESMSETPRAALASVKKTRKSPHATDPFPSRIKPMLALLSKMPADQEQYG
FEFKWDGIRAICYWDGESLRIESRNLLDITFRWPELQQLGELLGDSPAVLDGEIITLDEQ
GKVSFGLLKERMHLSKKPSLRLMQRVSPVYMIFDLLYYRDRSLMGLAYRERRKLLEKLGL
VSNHLQVPPSFPGRGEETLAAAIENDIEGIVAKRLESGYEAGKRSGAWIKIKTGNRQELV
IGGWVPEKGIRSRGVGALLVGYYDNARNLIFAGKVGTGFTDACRIELMNMLDKLEQESSP
FTTKPSKEAIYVKPQLVAEIEFREWTSDGVLRHPSFKGLREDKDPTEVVREDVAVQ
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtctcacatcgtaccgcgacaagcgggattttgcgaagactcctgaacca
gccggtgaaacggaatcgaaccataaggtcccgatattcgtggtgcagaaacatgatgcc
aagaagctccattacgattttcgcctcgaagtgaacggtgtgcttaaatcctgggcggtt
ccgaaaggtccttctcttgagccttcggtaaagagactcgctgtggctacggaagaccat
cctttggaatatgcggatttcgaaggatacattccggacggggaatatggagcaggccct
gttattgtctgggacagaggcttctattccaacattacccaaaaaagaggtcaggctctc
tccattgaacaagcgattgagcacggccacctgacggtccttctggatggagaaagactg
aaaggcgcctattcgctgagtcgaatccaatccggtgctaaagcgcaatggctcatggtc
aaagtcaaagataaattcgcagcggatcgggaccttgcgaccgagtttcaggactcggct
ttgagcggccggactctcgaggatatctcgaacgagtccatgtcagagacaccccgcgct
gctttggcctccgtgaagaaaacacgaaaatcacctcatgccacagacccgtttccgagc
aggattaagcccatgttggcgcttctgtccaagatgcccgcggatcaagagcagtacgga
tttgaattcaagtgggacggtatacgggccatctgctactgggacggagaaagcctccgt
atagaaagccgcaatctgctcgatatcacgttccgatggccggagttgcagcagttggga
gaactcctcggagacagcccggctgtgcttgacggggaaatcataaccctcgatgagcaa
ggaaaagtgagcttcgggttgctgaaagaacgaatgcatctttcaaaaaaaccttctctc
agactgatgcaacgagtttctccggtgtacatgatcttcgatctgctctattaccgcgat
cgatcgctcatgggtctggcgtacagagaaagacggaaactccttgaaaaactgggatta
gtttccaatcatctgcaggttccaccttcgtttccgggtcgcggtgaggagacactagct
gcagccatcgagaatgacattgagggaattgttgcgaagcggctggaaagtggatacgaa
gcaggaaaacgaagcggcgcatggattaaaatcaaaaccggcaaccggcaggaattggtc
atcggcggctgggtgcctgagaagggtatcagaagccgaggagtaggcgcattgctagta
gggtattacgataatgcccgcaatctgatatttgcaggaaaagtaggaacgggcttcact
gacgcgtgtcgaatcgaactaatgaacatgttagataagctggagcaggaaagcagtccg
tttacaacaaaaccttctaaagaggccatatacgtgaagccgcaactcgttgcggaaata
gaattcagagaatggacgtccgatggggttctcaggcatccatcattcaaagggcttcgt
gaagacaaggatccaacggaagttgtccgggaagatgtcgcagtgcagtga

DBGET integrated database retrieval system