KEGG   Desulfomonile tiedjei: Desti_0158Help
Entry
Desti_0158        CDS       T02147                                 

Definition
(GenBank) membrane carboxypeptidase (penicillin-binding protein)
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dti00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Desti_0158
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dti01003]
    Desti_0158
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dti01011]
    Desti_0158
Enzymes [BR:dti01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Desti_0158
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Desti_0158
Glycosyltransferases [BR:dti01003]
 Polysaccharide
  Bacterial polysaccharide
   Desti_0158
Peptidoglycan biosynthesis and degradation proteins [BR:dti01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Desti_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AFM22904
UniProt: I4C013
LinkDB All DBs
Position
complement(192465..194594)
Genome map
AA seq 709 aa AA seqDB search
MARHSKEILSVLLSVIKVLLALTAGYVLFTVGIVVWMFEVKLNRWPVFLYSAPFTLNVGD
DILNVKLAEHLSRISCTKTDSAVPEIGQWNQVGSAINVCLPYSPFRSYGMANGPVSIGLD
WNRVNSIRLMRSLNDAEALTLEPELLTILPADGYPQEFCRPLPLEHIPQLLVDAIVLTED
TRFFRHQGIDPISIVNALLANIKAGRYAQGASTITQQLIRMTLLTPEKTLFRKINEIVFA
VSADAIYSKKTILEAYLNRVYFGHWGAYPVKGVAEAAQFLFGKDLSELDPGECGLMAAII
RAPNIINPFKHPERAKARRNMILGLLLKEGKISREQYDESCSSSVKMRKSSAPALKAPAF
VELAKELLPRDLPGPEGARQDVLTSLDPILQQEAENLLKAFGDAGLSAHVVVTNPETGAL
KAYISPGPQKWAGTSTSLDNLLPLVFIPALLPERLDQVKYTLTSQVFVSQESGGPLTFRE
AFRKERQALFQKVWTGIGPEKITPVLKEFGVQVQTNGDKAVTNPLSPVEIAQIYSLMATL
GNSAVLGPGIKVVGDSSSKKEELRIRVPSNPGVIFMVNHMMKGLETVEIKERGQDKSEKY
PSLFYSRDDQGVWSIAYSGQAAVVVRMPGTHSEKKIRKMTEKLLAGASSGNVPQATPEGI
VFRNICVESGLRATSICSKVVREPFLKGTQPGEWCPMRHESKIKSSVQK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcgtcattcaaaagaaattctctccgtgttgctcagtgtaatcaaagtgctgctc
gcactgactgcgggttacgtgctgtttacggtcggcattgtggtttggatgtttgaagtc
aagctcaatcgctggccggtgtttctctattctgctcctttcactctgaatgtgggcgat
gacatcctgaatgtaaagcttgcagaacacctttctcgaatcagttgcacgaaaaccgat
tctgcagtcccggaaatagggcaatggaatcaagtaggttcggcgataaacgtatgtctg
ccctattcgcctttccgcagctacggcatggccaacggtcctgtgagcatagggctggat
tggaacagagtgaactccattcgtctgatgcgttccttgaacgacgcagaagccctgacg
ctcgaacccgagctattgaccattttgccggcagacggttatccccaggaattctgccgc
ccgttacccttggagcatattccccagcttctcgtagatgcaatcgtgctcacggaagat
acccgtttctttcgtcatcagggtatagatcccatatcgatcgttaacgcgctgctggcc
aatattaaagcgggcagatacgcccagggcgcaagcacgataacacagcagctcattcgc
atgactctgctgactcccgagaaaacattatttcggaaaataaacgaaatcgtctttgcg
gtttccgccgacgcaatctacagcaagaaaacaattctggaagcatatctgaatcgagtc
tacttcggacactggggggcatatccggtaaagggggtagccgaagctgctcaatttttg
ttcggaaaggacctctcggaactcgatccgggagaatgcggtctcatggccgcgatcata
cgggccccgaacattattaatcctttcaagcatccggaaagagccaaagccaggagaaac
atgatcctcggattactcctgaaagagggcaaaatctcaagagaacaatatgatgaatcc
tgcagcagctcagtcaaaatgcgaaaatccagcgcgcccgcacttaaggctcccgcgttc
gtggaactcgcaaaagaactcttacctcgagatctgcccggcccggagggagcacgtcag
gatgtgctgacttccctggatcccatacttcagcaggaagcggaaaaccttttaaaagct
ttcggagatgcaggtttgtcggcccacgttgtggtcacaaatccggaaaccggagcactg
aaagcctacatttccccgggaccgcagaaatgggccggcacttcgacaagtctggacaat
cttctgcctcttgtcttcatccccgcgcttctcccggagcgactcgatcaagtcaagtat
actcttacatcccaggtttttgtatctcaggaatccgggggcccattgacgtttcgagag
gcattcagaaaagaacggcaagctttgtttcaaaaagtgtggaccggcattggaccggag
aagatcactcctgtattgaaagaattcggagttcaggtccaaaccaatggagacaaagcc
gtgaccaatccgctctcccctgttgaaatcgctcagatatactctcttatggccaccctc
ggaaattctgcggtcttaggtcccggtatcaaggtcgttggtgattcgtcttctaaaaaa
gaggagctgagaatacgtgttccaagcaatcctggagtcatcttcatggtgaatcatatg
atgaaaggcttggagactgtggaaataaaagagcgcggacaagacaaaagcgaaaagtat
ccatcgctcttctattcgagagacgatcaaggggtatggtcaatcgcctattccggacag
gccgctgttgtggtgagaatgcccgggacacacagcgaaaagaaaatcagaaaaatgact
gaaaagctgttggccggtgcgagttccgggaatgtgcctcaagctacaccggaaggtata
gttttcagaaacatatgcgtggaatccggtttgcgcgctacatccatttgctccaaagta
gtgcgggaacctttcctgaaagggacccaacccggagaatggtgtcccatgagacacgaa
tcgaaaataaaatcgtcagtacaaaaatga

DBGET integrated database retrieval system