KEGG   Desulfomonile tiedjei: Desti_1571Help
Entry
Desti_1571        CDS       T02147                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00330  Arginine and proline metabolism
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
dti01130  Biosynthesis of antibiotics
dti01230  Biosynthesis of amino acids
Module
dti_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dti00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Desti_1571
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Desti_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 NAD_Gly3P_dh_N GFO_IDH_MocA TrkA_N ApbA CoA_binding Shikimate_DH Sacchrp_dh_NADP PDH CoA_binding_2 7TM-7TMR_HD
Motif
Other DBs
NCBI-ProteinID: AFM24282
UniProt: I4C3Z1
LinkDB All DBs
Position
complement(1869656..1870462)
Genome map
AA seq 268 aa AA seqDB search
MQHIGVIGAGNMGFALIRGFVSSGKSLGEHIRVFDVDQTRLSVLKNEFGVVPVTTLTDVA
TTDTEILIVAIKPQIMPAVLDELASHIGETKLVISIAAGISTRTMLSRLSQRARVIRVMP
NAPAMVGFGAAALCKAGGADQKDMDVALDLFSAVGVAVAVDEKYMNVVTALSGSGPGYLF
PIMEAFTDGAVRMGLDRVTARALTVQTFLGSAKMAETGASFSELKDRITSPGGTTIAGLQ
EMERAGLRGILMDVIEAATNRAQELDKD
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacatatcggtgtaatcggcgcaggaaacatgggtttcgcccttattagaggattt
gtgtcatcgggcaaatctttgggtgaacacattcgagtctttgacgtggaccaaacccgg
ttaagcgtgctcaagaacgagttcggcgtggtgccggtaacaacattgactgatgttgcg
acaaccgataccgagatactcattgtagcgatcaaaccgcaaatcatgcccgctgtgctg
gatgagcttgcgtcacatatcggcgaaacgaaactcgtgatttccatagccgcagggata
tctacccgaactatgctttcgcgtctttcccagcgcgctcgcgtcatccgagtgatgccg
aatgcacccgcaatggtgggattcggtgcagcagcactgtgcaaagccggaggagcggat
cagaaagatatggacgtcgctctggatctgttctctgccgtcggagtcgcagttgcggtg
gacgaaaagtacatgaacgtggtgacagccctttcaggaagcgggccggggtaccttttt
ccgatcatggaggcatttaccgacggagctgtccgtatgggactcgatcgggttaccgcg
cgggctttgacagtgcaaaccttcctgggttccgcaaaaatggcggaaaccggtgcgtcc
ttcagcgagctgaaagatcggatcacgtctcctggcggaacaaccattgccggattgcag
gagatggaacgggccggattacggggaatcctcatggacgtcatcgaagcggccacaaac
cgagcccaggagctggataaagattag

DBGET integrated database retrieval system