KEGG   Desulfomonile tiedjei: Desti_2724Help
Entry
Desti_2724        CDS       T02147                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00550  Peptidoglycan biosynthesis
dti01100  Metabolic pathways
dti01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dti00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Desti_2724
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Desti_2724
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dti01003]
    Desti_2724
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dti01011]
    Desti_2724
Enzymes [BR:dti01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Desti_2724
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Desti_2724
Glycosyltransferases [BR:dti01003]
 Polysaccharide
  Bacterial polysaccharide
   Desti_2724
Peptidoglycan biosynthesis and degradation proteins [BR:dti01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Desti_2724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AFM25401
UniProt: I4C760
LinkDB All DBs
Position
complement(3225915..3228809)
Genome map
AA seq 964 aa AA seqDB search
MKLLGKNRAAKFVFTVFFLIPLVVAIQIPIFAAGAALGTYLVFSQNLPDIPTLQSYEPRT
VSTFYADDGTVIGIFYKQKRFVVELEQIPPHVILAFLAAEDSRFYEHSGIDWYSVGRAIV
RNISAGRITQGGSTITMQVTRNFLLSRERTFSRKIREFILAPQLEAAWGKKKILYVYLNE
IYLGEGCHGVEAAARGYFDKPVEHLTVSEAALIAGLVASPSRYNPFKSEELARQRQATVL
GRMAKFGFLTEEQRKKALEEPLKFRKEVVRPFDVVPDFAEAVRRYIVRKYGEERLYNEGL
KVFTTCRVDYQKQAFEALEKGLQEIRGRQKNLAIVRTIPKEQISELLQRRSTPELHEGNV
YQGVVTRVIVHKTKNMDLEVWLSKKLRGMVRLDHVNQAFKVGQVLALKFDKFADDVPLFL
LDNDPKLQGALVCIENKTGFVRALVGGASMEQFKFNRATQAKRQPGSSFKPLIYSAAIEE
KSYSPATIIIDEPTEFELENPGEEWEPRNAGGDFLGPLSLRRALELSRNICTAKILFDVG
LDPVIDLARRMGITADLGRNLSLSLGTSEVSLFELTSAYTVFPNSGVHLEPVLVKRIEDR
FGNVLEENSEVPLLDESAIPRPVPREEFREQAALLDSRFDSRPSQITGPGVGGKQPAAGE
IKEEDTVRNSGGRKVVAALSPQTAYVMTSLLQGGVRHGTGARISNYVKRKDLAGKTGTTN
NAEDTWFIGFNPDYTTGVWVGFDEKRPVGNREEGARAALPIWGYFMRKVLENRPEREFPV
PPDITFKEMLTFTGNVSEGFTPKVVREPVYSPFSDLTLVTSPLDPPERLAEYRGIVIPGQ
YGQGAYLQMLPPGVQQTQPTGATPLHPMDGRNLFPEGSRPAPPAPNPGFQAPPGNPYQPV
RPTAPPAQSVLPQRQQESMPPTQANPNLPPQRRPDDSRTSAGPRSYPTYQPFTPAPRSPV
SNPQ
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttaggaaaaaacagagctgcaaaattcgtattcacggtattctttctcatt
cctctggttgttgcgatccagattcccatatttgctgccggggcagcactgggaacatat
ctcgtgttttctcagaatttgcccgacattcccacgttgcaatcatacgagccgcggact
gtctcaactttctatgcggatgatggaacggttatcggtatcttctacaagcagaaacgg
tttgtggtggaactcgagcaaattcctcctcacgtgattctggcattcctcgcggctgaa
gattcaagattttatgaacactcgggcattgattggtactctgtgggccgagcaatcgtt
cggaatatcagtgcagggaggataacacagggcgggagcaccataactatgcaggtgacc
cggaattttctcctttccagagagcgcaccttctcccgcaaaataagggaattcatcctc
gctccgcaacttgaggctgcgtggggaaaaaagaagattctgtacgtgtatctgaatgag
atttatctcggggaaggctgtcacggggtggaagctgcggctcggggatatttcgacaaa
cctgtggagcatttgactgtttccgaagctgccttgatcgcgggactcgtcgcaagtcct
tcacgctacaatcccttcaagagcgaagaactggcgagacagcgacaggccacagtgctc
ggacgaatggcgaaattcggatttttgactgaagagcaacgaaagaaagcacttgaagaa
ccgttgaaattcagaaaagaagtggtgcggccgttcgatgttgttcccgatttcgcagag
gctgtcaggcgctacatagtaaggaaatatggagaagaaagactctacaatgaaggtctc
aaggtcttcactacctgccgtgtggattatcagaaacaggcatttgaggctttggaaaaa
gggttgcaggaaatcaggggaagacagaagaatctcgccattgtgcgtactatcccgaaa
gaacaaatatccgaactcttgcagcgacgaagtacgcccgaacttcacgaaggaaatgtt
taccagggagtcgtgaccagggtcattgtccacaagacgaagaatatggatctcgaagtg
tggttgagcaagaaactcaggggaatggttcggctcgatcacgtaaaccaggcattcaaa
gtcggacaagtcctggctctcaagtttgataaatttgcggatgacgtgcctctcttttta
ctggataacgatccgaaactgcagggcgcgcttgtttgtatagaaaataagaccggattc
gtgagggcgcttgttggcggagcgtcaatggagcagttcaagttcaacagggccacgcag
gccaaacgccagccgggaagctctttcaagcctcttatctattccgcagctatagaggag
aagagctacagccccgcgacaatcattatcgatgaacccacagaattcgagttggagaat
ccgggcgaggaatgggagccgagaaacgcaggcggtgattttctcgggccgttaagtctg
cgtcgagcactggagctctcgcgcaacatctgcacagccaagatcctgttcgatgtgggg
ctcgatccggtcatagatcttgcccgaagaatggggattaccgcggatctgggccgcaac
ctgtcgttgagtctgggaacttcggaagtaagtcttttcgagctgacttctgcgtacacc
gtctttcctaatagtggcgtacacctcgaacctgtgctggtaaaacgcatagaagacaga
ttcggaaatgtgctcgaggagaattcggaagttccgctgctggacgagtccgctattcct
cggccggtgccgcgggaagaatttagagaacaggccgctctcttggattcgagatttgac
tctcgaccttcccaaattacaggacccggcgttggtggaaaacaacctgctgcaggggag
atcaaggaagaggataccgtcagaaactctggaggtcgcaaagttgtagctgcattatca
ccgcaaacggcgtacgtaatgacttcgcttttgcagggaggtgtacggcacgggaccggt
gcaaggataagtaattacgtcaagcgcaaagacctggcaggaaaaacaggaaccacgaac
aatgcggaggacacatggttcatagggttcaatcccgattataccaccggcgtttgggtc
gggttcgatgagaagcgtccggtcggaaatcgggaagagggggcccgcgctgcactgccc
atctgggggtatttcatgcgtaaagtcctggagaataggccggaaagagaatttccggtt
cctccggacattacgttcaaggaaatgctgacttttacgggcaacgtcagcgaaggcttc
acacctaaggtggtaagagaacctgtgtattcgccgttttcggatctgactctcgtgacc
agtccactcgatcctccagagagattggccgaatacaggggaatcgtgattccggggcaa
tacggccagggagcgtacctgcaaatgctaccgccgggggtgcagcagactcaaccaacc
ggggctactcctctgcatccgatggacggcagaaatttgtttccggaaggctccaggcct
gcgccacctgctcccaatcccggattccaggctcccccagggaatccgtatcagcctgta
cgaccgactgcaccaccggctcagtctgtgttacctcagcgacagcaggagagtatgccg
cccacccaggcgaatccaaacctgcctccacagaggagaccggacgattctcgaaccagt
gcaggaccgcgttcgtatccgacatatcagccttttactccggcaccaaggtctccggta
agcaatcctcaatga

DBGET integrated database retrieval system