KEGG   Desulfomonile tiedjei: Desti_2942Help
Entry
Desti_2942        CDS       T02147                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00970  Aminoacyl-tRNA biosynthesis
dti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dti00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desti_2942
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dti03029]
    Desti_2942
Enzymes [BR:dti01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Desti_2942
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Desti_2942
Mitochondrial biogenesis [BR:dti03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Desti_2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AFM25611
UniProt: I4C7S0
LinkDB All DBs
Position
3452715..3454151
Genome map
AA seq 478 aa AA seqDB search
MEYEAVIGLEVHAQLLTDSKAFCSCTTRFGNEPNTNTCPICQGMPGVLPVLNRKALEFTV
KMALACNCTINETSRFARKNYYYPDLPKNYQISQYELPVAEHGWLDVETNGEIRRIGITR
IHMEEDAGKLIHDENRPFSHVDLNRTGVPLVEIVSEPEMRSPEEAADYLRALRSILVYLE
VCDGNMQEGSFRCDANVSIRPKGTTALGVKAEVKNMNSFRNVQRALHYEIERQIETLKEG
GRIVQETRLFDPSTGTTASMRSKEQAHDYRYFPDPDLLPLRVEPELVERMRNQLPELPAE
KKERFIQLGIPAYDAGVLTASRPLADFFERTVELFPNPKAVSNWMMTEFMRELKGEEADI
SCCPVSPSQLANLLKSVEDGTISGKIAKTVFEEMFRTGKEPEEIIREKGLVQVSDTDELT
AACREVLDANAGEVAKYLSGKTKIFGFFVGQVMKKTKGKANPGLVNSILEEELKKRSE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgaagcagtaatcggactcgaagttcacgcccagctcctgacggactccaag
gctttttgttcgtgcaccacgcgtttcggtaacgagcctaatacgaatacctgccccatc
tgtcagggaatgcccggtgtgctgccggtcttgaaccgcaaggccctggaattcacagtc
aaaatggccctggcatgcaactgcaccattaacgagaccagcagattcgcacgaaagaat
tactactacccggatctccccaagaattaccagatttcccagtacgaactgcccgtcgcg
gaacacggctggctcgatgtggaaaccaacggagagattcgacgcatcggaataacaaga
atacatatggaagaagatgcagggaagctgattcacgatgagaatcgccccttctcccat
gtggatttgaaccggactggtgtgcccctcgtggaaatcgtctcagaacccgagatgcgg
tcacccgaagaggctgcggattacctccgtgcgctccggtccattctcgtatacctggaa
gtctgcgacggcaacatgcaggaaggcagttttcgttgcgatgccaacgtttccataaga
ccgaagggaaccacagcgctcggtgtcaaagcggaagtgaagaacatgaactccttccga
aacgtccagcgcgcactccattatgaaatcgaacggcagatcgaaacgttgaaggaaggt
ggaagaatagtccaggaaacccggcttttcgatccttccaccggcaccaccgcatccatg
cgaagcaaagaacaggcccatgattaccggtattttcccgatcctgatcttttgccgctt
cgcgtggaaccggaactcgtggagagaatgcgcaaccagctccctgaacttcctgccgag
aaaaaggaacgtttcattcagctcggtatcccggcgtacgatgcgggcgtgcttaccgca
tcgcgcccgctcgctgacttcttcgagcgcacagtagagctgtttccgaatcccaaagca
gtaagtaactggatgatgacggagttcatgcgggaactgaaaggggaagaagccgacata
agctgctgccctgtttctccgtcgcaactggcgaatcttctgaaatcggtcgaagacggc
acgatctccgggaaaatagccaaaaccgttttcgaggagatgtttcgcaccgggaaagag
cccgaagagatcatccgagagaagggtctcgtgcaggtatccgatacggacgagttaact
gccgcgtgtcgtgaagtactggatgcgaacgctggagaagtagccaagtatctttcgggt
aagacgaagatattcggttttttcgtcggtcaggtaatgaaaaagaccaaaggcaaggcg
aatcccggattggtcaattccatcctggaagaagagctgaagaagcgctcggaatag

DBGET integrated database retrieval system