KEGG   Desulfomonile tiedjei: Desti_4745Help
Entry
Desti_4745        CDS       T02147                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
dti  Desulfomonile tiedjei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 Pkinase Pkinase_Tyr ANAPC4_WD40 Nup160 TPR_2 WD40_like TPR_10 TPR_16 TPR_14 TPR_12 TPR_1 Cytochrom_D1 Coatomer_E
Motif
Other DBs
NCBI-ProteinID: AFM27365
UniProt: I4CCS4
LinkDB All DBs
Position
complement(5471608..5475294)
Genome map
AA seq 1228 aa AA seqDB search
MESQSTYASLTISCQDLDEVPAKIFDALAKLIKRTPASVRASLEIGTITLKKVHLGGDLE
RLIGVFRRNGLSVEVGLAESDVTDRALLSLPRKSATGFGLPYAESDAESQWKKGDLIEGL
YEVHGSASGGMGTVYFAFHRLWKMMIAIKTPQKVAIKSETHLLRFLREAELWVGLGLHPN
IATCYYARVIRGLPRLFIEYVDGGALEEWAEKNLLHDLRLLTDLMLQFCHGMMYAEENGM
VHRDIKPANCLITRDKIVKITDFGLVKRVDDPAHMNRPDDEHIADTTSSGRISNASVTLL
EGGVMGSPRYMAPERFREKGKEDIRSDIYSFGVMLYELVLDSMPFKLPLTYSLPELVRSH
LKAPVIDPRSLRPDIPGSLADIMLTCLQKKADNRYKSFQDVCHALESLSRELRPDRKPRN
RPNLVGLKADSLNNQAVSLLDLKRYDDARRLLEDAHSANTDHLEAVYNLHMLRWKNSESS
DRETIQRMEALKIEVRETPDYSYLMGLLSLQRGDPARAVSFLKKACHDGSWYQDRWKAYD
NDPKNFVNSLGFSTIGELISYAGHIKSVRSVAISSDARRAYSVGEDRSIRIWDTDSGRCL
KNFRTFTFMPVTGAFSQNDEFAATAYGTAFKTLDLWDLREGRLIKKFPGMSIFGVRFSPD
SQYLSCYDQEGAVRILEIPSGEVVWESRKLGSKVSSQVFLGNTGRIAIGCENGSLIVVDF
RSGTELFKTGAHMGAVTAVESTSDGEVIVTGGDDELMKLWEAQSGSEVLRFTGHRKELTG
IAVLPDDRYIVSVSADGCIKIWDGSSGRCYRTITIAGEDLTGCAISRDGKRLLTGSSKGS
VRLWSIDTGWFSQDYLEPALCRPRTFRELAGLHALFKITVEEFNRAWRKAHQTQALEAFE
RIRAIPGFCWSREAVLIRNVLHNVVVRGRLKSTSFIRAFHGHKDGVVAMKASPDNLLLLT
GSLDGTAAIWDVVTGRCIRKFVAGNPIREVFFLPRMQGVVTLSQDRVLRVWDQDGKMVQE
FPKLEPPLRMMPSGHEITAMCPEKMQVLLDLNTGKIHYKGAAVPGSEFICFSENLESVFS
LRDSTRIQRWSLATGRNEGAFRDLGIRITALLPATHEDKIVAGLESGDLTVYVGGSGVNV
ATLRGHAAAIRTIVSNPEGNLWITASDDCSIRLWDVPAEKCSAVLEGHSSSVRSLALFSN
LSLIASGDSEGSARLWGLEWAVSLEDQS
NT seq 3687 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgcagtcaacgtacgcttcgctcacaatatcttgtcaggacctcgatgaggtt
ccggccaagattttcgatgcgctggcaaaactgatcaaacgtacaccagcgagcgtgcga
gcttctctcgaaatcggcaccatcacactgaaaaaagttcaccttggcggagatcttgaa
cggcttatcggggtatttcgcagaaacggcttatccgttgaagtgggtttggccgaaagc
gacgtcaccgatcgggcgctgctcagtcttcctcggaaaagcgcgacaggattcggcctg
ccttatgctgaatccgatgccgaaagccaatggaaaaaaggcgatcttatcgaaggattg
tacgaagtgcacggttcggcttccggcggtatgggaaccgtgtattttgcattccatcgt
ctctggaagatgatgattgcgataaagacgccgcaaaaggttgcaataaagagcgaaaca
cacctgctgagatttctcagagaagcggaactctgggtcggactggggctgcatccgaat
attgcgacctgctattacgctcgcgtgatacgaggacttcccaggttatttatcgaatac
gttgatgggggcgcactcgaagaatgggcagagaaaaacctcttgcatgatttgcgactt
ctgaccgatctcatgctccagttctgccacggaatgatgtatgcggaagaaaacggcatg
gttcaccgtgacattaaacccgcaaattgcctcatcacgcgagacaaaatagtcaagatc
actgatttcggcttagtaaaacgagtggatgaccccgcacatatgaaccgccctgatgac
gaacacattgcggacacaacttccagcggcagaatctcgaacgctagcgtcactttgctt
gaaggcggagtcatgggctccccgcgatatatggcgcctgaaagattcagagaaaaaggg
aaagaggatattcgatccgacatttactcgttcggcgtcatgttgtacgagctggttctc
gactcaatgccgttcaagctccctctcacctattctctcccggagttagtgcgaagccat
ttgaaagctccggttatcgatcctcgttcgctgagacccgatattcccggatccctggcc
gacatcatgctaacgtgtcttcagaaaaaggccgataatcgatacaaatcttttcaggat
gtgtgtcacgctctcgagtcgctctccagggaattgcgacccgatcgaaaaccccgtaat
cgccccaacctggtcggtctcaaggcggattctctgaacaaccaggctgtgtcactcctg
gacttgaaaagatacgacgacgcaagaagacttcttgaggacgctcattcggcaaatacc
gaccatttggaagcagtatacaatcttcacatgctgcgctggaagaactccgaaagttcc
gaccgcgagactatccagaggatggaggccctcaaaattgaggtcagagaaacacccgat
tactcgtaccttatggggttgctttcgctgcaaaggggagatccggctcgagctgtatca
tttctgaaaaaggcctgtcatgacggttcatggtatcaggatcgctggaaagcctatgat
aacgatccaaagaattttgtgaactctctggggttctcgacaatcggcgagttgatctcg
tatgccggtcacatcaagagtgtccgctccgtcgcgatttcttcagatgccagacgagcg
tattcagtcggtgaagatcgttcaatcagaatctgggatacggatagcggtagatgtttg
aaaaatttccgtacttttaccttcatgcccgttaccggagccttctcccagaatgatgaa
ttcgcagcgacggcttacggcacggcttttaagacgttggatttgtgggaccttcgcgaa
ggccggctgatcaagaaattccccggcatgagcatttttggcgtcaggttttctccggat
tcccagtacctctcgtgctacgaccaggaaggcgctgtccgcattctcgaaatcccttct
ggagaggttgtgtgggaatcacggaaattgggctcaaaggtttcatcacaggtttttctg
ggaaacacgggacggattgccattggttgcgaaaatggttctctgattgtggtggatttc
cgttccggcacggaactctttaaaacaggcgctcacatgggagctgttactgcagttgaa
tccacgtcggatggcgaagtcatcgtcaccggcggtgatgatgaactgatgaaattgtgg
gaagcgcaatccggctcggaggtccttcggtttaccggacatcgaaaagaattgaccgga
atagcggtgttgccggacgatagatacattgtctccgtttctgccgatggatgtataaag
atatgggacggttccagcgggagatgttaccgaaccatcacgatagccggagaagacttg
accgggtgcgctatttccagggatggcaaaagattgcttaccggttcctccaaaggttcc
gtaagactttggagcatcgataccgggtggttctcacaggattatctggaacctgctctt
tgcaggccgcgaacgttcagagaactggccggcttgcatgctctgtttaagattactgtc
gaagagtttaaccgtgcgtggcggaaagctcatcaaacgcaggcattggaagctttcgag
cgcattcgtgcgattcccgggttttgttggtccagggaagcggtgctaatcaggaacgta
ctgcataatgtggttgttcggggacgcctgaaatccacatcctttattcgcgcatttcat
ggtcacaaggatggggtagttgccatgaaggcaagcccggacaatttgctgctcctgacc
ggaagtcttgacggcactgcagccatttgggatgtggttaccgggcgctgtatccgaaaa
tttgtcgcgggaaatcccattcgagaagtgttcttcttgcctcggatgcagggtgtggtg
acgctgagtcaggatcgcgtgcttcgtgtgtgggatcaggacggaaaaatggtgcaggaa
ttcccgaaactcgaaccacctctcaggatgatgccctcaggacacgaaattactgcaatg
tgtccggagaagatgcaggtactgctcgatctgaacaccggcaagatacattacaaaggc
gccgctgttcctgggtccgaattcatctgtttttccgaaaatctggagagcgtgttcagt
ttgcgggacagcacaagaattcaaagatggtcgcttgccaccggccgtaatgagggagca
tttcgggatttgggaataagaatcaccgctcttttgcctgctactcacgaggataagatt
gtcgccggcctggaatcaggcgacctgacggtctatgtcggaggctctggggtcaatgtc
gccactctgagagggcatgccgcggccatacgcactatcgtgtcaaatccggaaggcaat
ctttggatcactgcttcggacgattgctccataagactctgggacgtacctgctgagaaa
tgctccgcggtcttggagggacattcatcctctgtgcggtccctggcattgttctcgaat
ctttctttaattgcttcaggtgatagtgagggatctgctcggctctggggactggagtgg
gcggtttctttggaagaccagagttga

DBGET integrated database retrieval system