KEGG   Dietzia timorensis: BJL86_0624Help
Entry
BJL86_0624        CDS       T04608                                 

Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
dtm  Dietzia timorensis
Pathway
dtm00071  Fatty acid degradation
dtm00280  Valine, leucine and isoleucine degradation
dtm00281  Geraniol degradation
dtm00310  Lysine degradation
dtm00362  Benzoate degradation
dtm00380  Tryptophan metabolism
dtm00410  beta-Alanine metabolism
dtm00640  Propanoate metabolism
dtm00650  Butanoate metabolism
dtm00903  Limonene and pinene degradation
dtm00930  Caprolactam degradation
dtm01100  Metabolic pathways
dtm01110  Biosynthesis of secondary metabolites
dtm01120  Microbial metabolism in diverse environments
dtm01130  Biosynthesis of antibiotics
dtm01200  Carbon metabolism
dtm01212  Fatty acid metabolism
Module
dtm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BJL86_0624
   00650 Butanoate metabolism
    BJL86_0624
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJL86_0624
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJL86_0624
   00310 Lysine degradation
    BJL86_0624
   00380 Tryptophan metabolism
    BJL86_0624
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJL86_0624
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BJL86_0624
   00281 Geraniol degradation
    BJL86_0624
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJL86_0624
   00930 Caprolactam degradation
    BJL86_0624
Enzymes [BR:dtm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BJL86_0624
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BJL86_0624
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BJL86_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C NAD_binding_8 UDPG_MGDP_dh_N F420_oxidored NAD_Gly3P_dh_N DAO
Motif
Other DBs
NCBI-ProteinID: ANI91426
UniProt: A0A173LGH8
LinkDB All DBs
Position
667287..669479
Genome map
AA seq 730 aa AA seqDB search
MATNTINYSIDDDGVVTLELDDPNQNANTMNENYVSSMENAVAKIVDEHESGKVSGVIIT
SAKKTFFAGGDLRDLLAIPLDEPAAAQDTTDRVTAPLRELETLGIPTVAAIAGSALGGGL
EIALSCHRRIVVDNPKIQLGLPEVGLGLLPGGGGVARSVRLLGVESALMNVLLEGKRHRP
DSALQVGIVDDIVASAEELIPAAKKWIAENPESRQPWDEKGYTMPGGSPKDRSLSSKLPM
FPALLRKQLKGAPYPAPIAIMSAAVEGARLGFDDARTVERRYFGHVVASQTAKNMIRAFF
FDLQTANGMTSQAAKSVDKPVDKLTVLGAGMMGAAIAYVCAKAGIDVVLKDISIEAANKG
KDYSEKLVDKSVSRASGEAAEVARKRGAELLSRITPTDDPAATAGSQAVIEAVFEDPDVK
TKVFAEIAPYIEADALLCSNTSTLPITELARGMDRPADFIGLHFFSPVDKMPLVEIIKGE
QTSAETLDRALSIVGRISKTPIVVNDSRGFFTSRVIGTFTNEGVSMLGEGIPASQIEQAS
SQAGYPAPVLSLMDELTLTLPRKIREETKAAAQREGKGWVESGADAVIDRMIDEFDRKGR
STGAGFYEYSDGKRTRLWPGLTENFGGTSEIPMRDAIDRLLFIEAIETVKCLDEGVLEST
TDANVGSILGIGYPGWTGGVSRFIDQYPGGLAGFVARAGELAERYGERFTPPQSLVAKAD
SDGTYEEVRA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaacaccatcaactactcgatcgacgacgacggcgtcgtcaccctcgagctc
gacgacccgaaccagaacgccaacaccatgaacgagaactacgtttcgtccatggagaac
gccgtcgccaagattgtcgacgaacacgaaagcggaaaggtctccggcgtgatcatcacg
tccgcgaagaagacatttttcgcaggcggcgatctgcgcgacctgctggcgatcccccta
gacgagccggcggccgcacaggacacgacggaccgagtcacagcgccgctgcgcgaactc
gagacgctgggaatccccacggtcgccgcgatcgccggctccgcgctcggaggcgggctg
gaaatcgcgctgtcctgccaccgccgcatcgtcgtcgacaacccgaagatccagctcggt
cttcccgaggtcggcctcggcctccttcccggaggcggcggcgtcgcccgctcggtccgg
ctcctcggcgtcgaatccgcactgatgaacgtgctcctcgagggcaagcgccaccgcccg
gactccgcgttgcaggtcggcatcgtcgacgacatcgtcgcgagcgcagaggagctgatt
cccgccgcgaaaaaatggatcgccgagaatccggaaagccgacagccatgggacgagaag
ggctacacgatgcccggtggttccccgaaagaccggagcctgagctccaaattgccgatg
ttcccggcactgctgcgcaagcagctcaagggcgcgccataccccgcgccgatcgcgatc
atgtccgcagccgtcgagggcgcgcggctcggcttcgacgatgcccgcaccgtcgaacgc
cgctacttcggtcacgtcgtcgcaagccagaccgccaagaacatgatccgcgcgttcttc
ttcgacctgcaaaccgccaatggtatgacgtcgcaggccgcgaaatcagtggacaagccc
gtcgacaagctcaccgtactcggcgccggaatgatgggcgccgccatcgcctacgtgtgc
gcgaaggccggcatcgacgtagtcctcaaggacatctcgatcgaggcggcgaacaagggc
aaggactactcggagaagctcgtcgacaagtccgtctctcgcgcatcgggcgaggccgcg
gaggtcgcacggaagcggggcgccgagctcctctcgcgcatcacccccaccgatgacccg
gccgcgactgccggctcccaggccgtcatcgaggccgtcttcgaggatcccgacgtcaag
accaaggtcttcgccgagatcgccccctacatcgaggccgacgcgctgctgtgctcgaac
acctcgaccctccccattacggaactggccagagggatggaccgcccggcagacttcatc
ggactccacttcttctcgcccgtggacaagatgccgctcgtcgagatcatcaaaggcgag
cagacctcggcggaaacgctggaccgtgcgctgtcgatcgtgggcagaatctccaagacc
ccgatcgtcgtcaacgactcccgcgggttcttcaccagcagggtcatcggcaccttcacg
aacgagggagtgtcgatgctcggcgagggcatccccgcctcccagatcgaacaagcctcc
tcgcaggccgggtatccggcgccggtgctctcgctcatggacgagctcacgctcaccctc
ccgcgcaagatccgcgaggagaccaaggccgcggcgcagcgggagggcaagggctgggtc
gaaagcggcgccgacgccgtcatcgaccgaatgatcgacgaattcgaccgcaagggccgc
tcgaccggtgccggtttctacgagtactcggacggcaagcgcacgcgactgtggcccggc
ttgacggagaacttcggcggtacgagcgagatcccgatgcgcgacgccatcgaccgactt
ctgttcatcgaagcgatcgagacggtcaagtgcctcgacgaaggcgtcctcgaatcgacc
accgacgcgaacgtcggctcgatcctcggtatcggctatcccggctggaccggtggagtt
tcccgattcatcgatcaatatcccggcgggctggcaggattcgtagcacgtgcaggcgag
ctcgccgagcgatacggcgagcgattcacaccgccgcagtcgcttgtcgcgaaggcggac
tccgacgggacctacgaggaggtccgggcatga

DBGET integrated database retrieval system