KEGG   Dietzia timorensis: BJL86_0979Help
Entry
BJL86_0979        CDS       T04608                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
dtm  Dietzia timorensis
Pathway
dtm00020  Citrate cycle (TCA cycle)
dtm00480  Glutathione metabolism
dtm01100  Metabolic pathways
dtm01110  Biosynthesis of secondary metabolites
dtm01120  Microbial metabolism in diverse environments
dtm01130  Biosynthesis of antibiotics
dtm01200  Carbon metabolism
dtm01210  2-Oxocarboxylic acid metabolism
dtm01230  Biosynthesis of amino acids
Module
dtm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dtm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:dtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJL86_0979
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJL86_0979
Enzymes [BR:dtm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BJL86_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ANI91772
UniProt: A0A173LM16
LinkDB All DBs
Position
1053346..1054563
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWKFIKDKLIHPYLDLNLEYYDLGIESRDATDDQITVDA
ANAIKKHGAGVKCATITPDEARVEEFGLSRMYRSPNGTIRNILGGTIFRAPIIIDNIPRL
VPGWTKPIIVGRHAFGDQYRATDFKAPGAGTVTITYTPDDGSEPIEHEVVKLPEDGGVVM
GMYNFNKSIEDFARASFNYGLQRNYPVYLSTKNTILKAYDGQFKDIFQDVFDREFKAEFD
AAGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDIVAQGFGSLGLMTSVLLTPDG
QTCEAEAAHGTVTRHFRQHQQGKPTSTNPIASIFAWTRGLDHRGKLDNTPEVREFAGKLE
DVVIKTVESGKMTKDLALLAEGDQDYLTTEEFLAAIDENLQAAFR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatcaaggttgaaggaaccgttgtcgagctcgatggcgacgagatgactcgt
atcatctggaagttcatcaaggacaagctgattcacccttacctcgacctcaacctcgaa
tattacgacttgggcattgagagccgggacgccacggacgaccagatcacggtcgacgcg
gcgaatgcgatcaagaagcacggcgcgggcgtcaagtgcgcgaccatcacgccggacgag
gcgcgcgtggaggagttcggcctcagccggatgtaccgctcgccgaacggcacgatccgt
aacattctcggcggcacgattttccgcgcgccgatcattatcgacaacattccccgcctg
gttccgggctggaccaagccaattatcgtcggtcgtcacgcgttcggcgatcagtaccgc
gccaccgacttcaaggcgcccggcgccggtacggtcaccattacctacaccccggacgac
ggcagcgagccgatcgagcacgaggtcgtcaagctgcccgaggacggtggcgtcgtcatg
ggcatgtacaacttcaacaagtccatcgaggacttcgcgcgcgcttcgttcaactacggt
ctgcagcgcaactacccggtgtacctgtccacgaagaacacgatcctcaaggcctacgac
ggccagttcaaggacatcttccaggatgtgttcgatcgtgagttcaaggccgagttcgat
gcggccggcctcacctacgagcaccgcctcatcgacgacatggtcgcctccgcgctcaag
tgggagggcggctacgtgtgggcctgcaagaactacgacggcgacgtccagtccgacatc
gtcgcgcagggcttcggctcgctcggcctgatgacgtcggttctcctcacgccggacggg
cagacgtgtgaggcggaggccgcccacggcaccgtcacgcgccacttccgccagcaccag
cagggcaagccgacctccacgaacccgatcgcctcgatcttcgcgtggacccgcggactc
gatcaccgtggcaagctcgataacaccccggaggtgcgcgagttcgccggcaagctcgag
gacgtcgtcatcaagaccgtcgagtcgggcaagatgaccaaggacctcgcgctcctcgcc
gagggcgaccaggattacctcaccaccgaggagttcctcgccgcgatcgacgagaacctg
caggccgcgttccgctaa

DBGET integrated database retrieval system