KEGG   Dietzia timorensis: BJL86_2439Help
Entry
BJL86_2439        CDS       T04608                                 

Definition
(GenBank) G/U mismatch-specific DNA glycosylase
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
dtm  Dietzia timorensis
Pathway
dtm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:dtm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BJL86_2439
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dtm03400]
    BJL86_2439
Enzymes [BR:dtm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     BJL86_2439
DNA repair and recombination proteins [BR:dtm03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BJL86_2439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ANI93203
UniProt: A0A173LMS7
LinkDB All DBs
Position
2625557..2626171
Genome map
AA seq 204 aa AA seqDB search
MGGRKPTNADLPAFATPNPDAIDDVLPAPGTRLRMLIVGVNPGLWTAAVNGPFARPGNRF
WPSLHRAGLTGHQIDASLGLSDDDARHLALRGIGITNLVGRATTRADELSKDELRAGGRR
LVERLPQLRPDVVAVAGITAFRVAFDDRKAVLGEQDTTAIGGWPGGVRLWAVPQPSGLNA
HENIDSLAAKWQTVWDAATDAASD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgggagggcgcaagcccaccaacgccgacctgccggcattcgccacgccgaaccccgac
gccatcgacgacgttcttcccgcacccgggacccggctgcgcatgctcatagtcggggtc
aatccggggttgtggacggccgccgtcaacggcccctttgccaggcccggaaaccgtttc
tggccatccctccaccgcgcaggcctgaccgggcaccagatcgacgcctcgttgggattg
tccgatgacgacgcacgccacctcgcgctccgcggaatcggaatcaccaacctcgtcgga
cgggcgacgacgcgcgcggacgaactaagcaaggacgaactgcgagcgggcggccgccga
ctggtggagcgactgccgcagctacgccccgatgtcgtcgcggtcgcgggaatcaccgcg
ttccgggtggctttcgacgaccggaaagccgtcctcggcgaacaggacaccacggcgatc
gggggctggccgggcggcgtgcgattgtgggcggtcccccagcccagcgggctcaatgcc
cacgagaacatcgactcactggcggcaaaatggcagacggtatgggacgctgccacggat
gcggcctccgattag

DBGET integrated database retrieval system