KEGG   Dietzia timorensis: BJL86_2779Help
Entry
BJL86_2779        CDS       T04608                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
dtm  Dietzia timorensis
Pathway
dtm03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dtm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BJL86_2779
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dtm03400]
    BJL86_2779
Enzymes [BR:dtm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BJL86_2779
DNA repair and recombination proteins [BR:dtm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BJL86_2779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ANI93539
UniProt: A0A173LPF1
LinkDB All DBs
Position
complement(2970600..2973071)
Genome map
AA seq 823 aa AA seqDB search
MATNGRKVDVEGHELKVTNLDKVFYPSTGTSKADVIDYYSRIAPVMVPQATRRAATRKRW
VNGVGTKADPAKAFFRKNLERSAPSWVPRADIEHKKGTSTYPLIDERAVLVWLAQVAALE
IHTPQWRFDEENEPLNPDRLVLDLDPGEGVELRQCAEVAVWCREIIDGMGLDAFPVTSGS
KGLHIYSPLDGSTTAEEADAVARELARALQADHRDHVVSEMSKSSRKGKVFIDWSQNNGS
KTTICPYSLRGRMRPTVAAPRTWDEISDPELRHIEYDEVLRRVEEGIDPIAEMGHEPSHT
RGRRGKAEGTRRANRLEKYKSKRDRTRTPEPIPETQVHHDDSESAIESEDPIFVIQEHHA
SSVHWDFRLEHDGVLASWAVPKGPPGAQGVNRLAVATEDHPLEYATFEGTIPKKEYGGGE
VAIWDVGTIDVDKWCEGREVVVTCYGRADGGLGGEPRKFALIHTGEKTGTSGAGNDSHWI
LRLTKHQPQPGRSGTGPSISTPVSPMLATLGSAKDITNSKDWAFEMKWDGVRAVATVTSA
TVILSSRKGHDLTATFPEFGDLGKAIDRRTLNEGDVIVDGEIVAFDAKDRPSFSLLQQRL
GLTTKAKIRSAQERFPAFFMAFDLLACGGRSMLATPYGERRSALREVVDETAHLRIPHAD
PGDVDHAIALSQQLELEGVVAKQLSSVYRPGKRGKTWIKIKNAREQEVVVIGWRHGKGER
SGRIGSLLLAVPDDEGQLHYAGRVGTGFSEKDLDDIARRLRGRERKTAPAAGVPAADRRD
AEWVRADLVAEVRYAERTTEGRLRHPSWRGWRRDKSPNEVTWE
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaacggtaggaaagttgacgtcgaaggccacgaactcaaggtgacgaacctt
gacaaggtcttctacccctcgacgggcacgagcaaggccgatgtgatcgactactacagt
cgaatcgcccccgtaatggtgccccaggcaactcggcgtgctgccactcgcaagcgatgg
gtaaatggtgtcggtacgaaagcggaccccgcgaaggcattttttcgaaagaacctggag
cggtcggcgcccagctgggtgcctcgcgcggacatagaacacaaaaagggtacgtcgacg
tatcccctgattgacgagcgcgcggtgttggtatggctggctcaagtcgcggcgctggag
atacatacgccgcagtggcgattcgacgaagaaaacgagccactcaaccccgatcggctg
gtactcgacctggacccgggcgagggggtcgaactgcgtcaatgtgccgaggttgccgtg
tggtgtcgcgagataatcgacggaatgggcctggacgctttccccgtcacgtccgggtcg
aaaggccttcatatctattcccctctcgacggatccacgaccgctgaggaggcggatgcc
gtggcgcgtgagcttgcgcgagcgctacaggccgaccacagggaccacgtggttagcgaa
atgtccaagtcgagccgcaaggggaaagtcttcatcgattggtcccagaacaacggcagt
aagacgaccatctgtccgtattcgctgcgcggcaggatgcgacctacggtggcggcgccg
agaacctgggatgagatttccgatccggagcttcgccacatcgaatatgacgaagtgctc
cgtcgcgtcgaggaggggatcgaccccatagcggaaatggggcacgagccatcgcacaca
cgaggtcgacgcggcaaagccgaaggaacccggcgggcgaatcgactcgagaagtacaaa
tcgaagcgcgaccgcacccgaacgcccgaacccattcccgaaactcaggtccatcacgat
gacagcgagagcgcgatcgagtcggaagaccctatattcgtcattcaggaacaccatgcc
agctcggtgcattgggattttcgcctcgaacatgacggcgtgctcgcttcgtgggcggtg
cctaaagggcccccgggagctcagggcgtcaatcgcctcgcggtggccaccgaagatcac
ccactggaatacgcgacgttcgaaggcaccatcccgaagaaggagtacggcggcggagaa
gtcgcgatttgggatgtcggcacgatcgacgtcgataagtggtgtgagggccgggaagtc
gtcgttacttgttacggcagggccgacggtggtctcggcggagagccccgaaaatttgca
ttgatccacaccggtgaaaagaccggcacgtcgggcgccggaaatgattcccactggatt
cttcgtctgacaaaacaccagccacaaccggggcgctctgggaccggtcccagcatctca
acgccggtatccccgatgctggcgacattgggaagtgctaaggacatcactaattcgaaa
gactgggcgttcgagatgaaatgggacggtgtgcgagcggttgccacggttacttcggcg
acggtcatcctgagcagccgtaaaggccacgatctcacggctacctttcccgagttcggc
gatctggggaaagcgatagatcggcgcaccttaaacgaaggagacgtcattgtagatggc
gaaatcgtggctttcgacgccaaggatcgcccttccttctccttgctccagcagcgcctt
ggattaacgacgaaggcaaaaatacgttctgcccaagaacgcttccccgcattctttatg
gccttcgacctgcttgcatgcggcgggagatcgatgctggccacgccgtacggtgagcga
cgaagcgcgctccgtgaagtggtcgacgaaaccgctcatcttcggattcctcacgcggac
cctggggacgtcgatcacgcgatagcgctgtctcaacaactcgagttggagggcgtggtg
gcgaagcagctttcgagtgtctaccggccgggcaagcgtggaaaaacgtggatcaagata
aagaatgcccgcgagcaggaagtcgtcgtcattgggtggcggcatggaaaaggagagcgt
tccggtcggatcggttcacttttgctcgccgtgccggatgacgaaggccaactccactac
gcgggccgggtaggcacggggttcagcgagaaagacctcgacgacatcgctcgccggctc
cgcggccgcgaaaggaagacggccccggcagccggcgttcctgcggcggatcgacgcgac
gccgaatgggtgcgcgccgatctcgtggccgaagtcaggtatgccgaacgcacgaccgag
gggcggttgcgtcacccgtcgtggcgcggctggcgtcgcgataagtcccccaacgaggtc
acctgggagtga

DBGET integrated database retrieval system