KEGG   Defluviitoga tunisiensis: DTL3_0628Help
Entry
DTL3_0628         CDS       T03867                                 

Gene name
porA
Definition
(GenBank) Pyruvate synthase subunit PorA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
dtn  Defluviitoga tunisiensis
Pathway
dtn00010  Glycolysis / Gluconeogenesis
dtn00020  Citrate cycle (TCA cycle)
dtn00620  Pyruvate metabolism
dtn00640  Propanoate metabolism
dtn00650  Butanoate metabolism
dtn00680  Methane metabolism
dtn01100  Metabolic pathways
dtn01110  Biosynthesis of secondary metabolites
dtn01120  Microbial metabolism in diverse environments
dtn01130  Biosynthesis of antibiotics
dtn01200  Carbon metabolism
Module
dtn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dtn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DTL3_0628 (porA)
   00020 Citrate cycle (TCA cycle)
    DTL3_0628 (porA)
   00620 Pyruvate metabolism
    DTL3_0628 (porA)
   00640 Propanoate metabolism
    DTL3_0628 (porA)
   00650 Butanoate metabolism
    DTL3_0628 (porA)
  09102 Energy metabolism
   00680 Methane metabolism
    DTL3_0628 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DTL3_0628 (porA)
Enzymes [BR:dtn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DTL3_0628 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: CEP77943
UniProt: A0A0C7NX42
LinkDB All DBs
Position
I:complement(663213..664382)
Genome map
AA seq 389 aa AA seqDB search
MPVKLTVTGAHAVAHAMRQINPDVVAAYPITPQTPVVEYYANFVADGIVDTVLVPVESEH
SAMSAVVGAAAAGARTMTATAANGLALMIEIVYIAASNRLPIIMPVVNRALSGPLNIHCD
HSDAMLARDSGWIQFFTENHQEAYDFMIIATKLAEKENVLLPVMVNLDGFITSHGVESFE
MLDDEVVKEFVGTWNPKYSLLDTQNPVTYGPVDLFDYYFEHHRQQEEGMKHAYEELPKVF
EEFAEISGRKYDFLDLYKTDDADYIMVIMNSTASTAKYVVDELREEGKKVGLIKPQVFTP
FPKKEFQKVLNGRKGVIVLDRAMSFGKEAPLYSLIKSSLYEVPSRPKLGSYIYGLGGRNT
SPKMIRQAFEDAFNGNLLADEQRYLGLRE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgaaattaactgttacaggagctcatgctgtagctcatgctatgaggcaaatt
aatcctgatgttgtggcagcttatcctatcacgcctcaaacacccgtagttgaatattat
gcaaattttgttgcagacggaatagttgatactgtactagtccccgttgaatctgaacat
tcagctatgagtgcagttgttggagctgctgctgcaggtgctagaactatgacagcaacc
gctgctaatggattagccttaatgattgaaattgtatacatagctgcttcaaatagatta
ccaattataatgcctgttgtaaatagagccctttctggccctttaaacattcattgtgat
cattctgatgcaatgttggctagagattcaggttggattcaattttttactgaaaaccac
caagaagcttatgattttatgataatagccaccaagttagctgaaaaagaaaatgtgctt
ttaccagttatggttaatttagatggatttatcacttctcatggtgttgaaagctttgaa
atgcttgacgatgaagtggttaaggagtttgtaggaacttggaatcccaaatattctcta
cttgatactcaaaatcctgtaacttatggaccggttgatctttttgattattattttgag
catcatagacaacaagaagaaggcatgaaacatgcgtatgaagaattaccaaaagttttt
gaggaatttgcagaaatttctggtagaaaatacgactttcttgatttatataaaaccgac
gacgctgactatataatggtaataatgaattctacagcatcaaccgcaaaatatgtagtt
gatgaacttagagaagaaggaaaaaaggttggattaattaagcctcaagtttttacacct
tttcctaaaaaagaattccaaaaagttttgaatggtcgcaaaggagttattgttttagat
agagctatgtcttttggaaaagaagctcctttgtattcattaataaaatcttcattatac
gaagtaccttcaagaccaaagcttggttcttatatttatggtttaggaggaagaaacaca
tctcctaaaatgataagacaagcttttgaagacgcttttaatggtaatttactcgctgac
gaacaaagatatttaggattaagagaataa

DBGET integrated database retrieval system