KEGG   Defluviitoga tunisiensis: DTL3_1223Help
Entry
DTL3_1223         CDS       T03867                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dtn  Defluviitoga tunisiensis
Pathway
dtn00500  Starch and sucrose metabolism
dtn01100  Metabolic pathways
dtn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dtn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DTL3_1223
Enzymes [BR:dtn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     DTL3_1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Glyco_transf_5 Phage_int_SAM_5
Motif
Other DBs
NCBI-ProteinID: CEP78524
UniProt: A0A0C7P3R7
LinkDB All DBs
Position
I:1322354..1324921
Genome map
AA seq 855 aa AA seqDB search
MNFINKITVVPKLPEEIVGLKELSENMWWTWNYKAQQLFKKIDENLWNSVQRNPVVFLKK
VEQKKLNSAVASNDFMSLYQEVMNNFHNYMNEDQKTWFKKTHSHTNYGEIAYFCMEYGMH
ESFPMYSGGLGILAGDHIKSASDLGIPLVAVGLLYRKGYFIQKINSEGWQESIYLDYDFS
DFPIHPAVDQNGEEVYVSITLPERTVYIKVWEIKVGRVKLYLLDTDLLQNDPEDRKITST
LYGGDLEMRIKQEMVIGIAGVRALRKLGYKPSVWHMNEGHSAFLGLERIREFVQEYNLSF
SEAVQAVRAGNIFTTHTPVPAGNDLFPIYLIDKYFGDYWPQLKATRQDFLDLGLEKQKSG
ESLFSMAILALKLSGRANGVSKLHGTVSKKLWNHVWPGIEWVEVPITYVTNGVHINSWLN
PLLQESFKKYLGEDWMLKIDDPDLWTKINDIPNEELWKIHMLLKKELIKFVRESIKAQRM
RHGETVEQLEEVENIGNEEALTIGFARRFATYKRADLIFKDPERLKKILNNPERPVELIF
AGKAHPADKPGQELMKKIYEYSRDPEFKNKIIILENYDMNMARFLVSGVDIWLNNPRRPL
EASGTSGQKAGMNGAINFSVLDGWWNEGYNGKNGWTIGDDRDYENHELQDKIDSVSIYNQ
LEKQIVPLYYERGNGNIPQEWIEKMKESLKSVTSFFNTYRMLKEYTQKLYMPASEQHRNF
CSNDFKVVKDFTKWLNLLKENWNSIKIHVMFDYEKSQIINAEEEIEIQAEIYMPGIGPDS
IIAEIVVASLQNGKIEQLKTYDMKLVKEIQKDAYLYTGKIKIEDRGEYGINVRVTPNHPY
MPHKNYLMGLVKYPE
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattaataaaattacagtagttccaaagttaccagaagaaatagttggtttg
aaagaactttcagaaaatatgtggtggacttggaactataaggctcaacagttgtttaaa
aaaattgacgaaaatctttggaattctgtccaaagaaaccctgtggtgtttctaaaaaaa
gttgaacagaaaaaattgaattccgctgtagcaagcaatgattttatgagtttatatcaa
gaagtgatgaataatttccataattatatgaatgaggatcaaaaaacttggtttaaaaag
actcatagccacactaattatggtgaaatagcttatttttgtatggaatatggaatgcac
gagtcatttcctatgtattccggcggattaggaatacttgctggagatcatattaaaagt
gcaagtgatttaggaatacctttagtagcagtaggacttctttatagaaaaggatatttt
attcagaaaatcaattctgaaggatggcaagaaagtatatatttagattatgatttttct
gattttcctatacatccagctgtagatcaaaatggtgaagaggtttatgtttctataaca
ctacctgaaaggactgtatatataaaagtttgggagataaaagttggaagagttaaatta
tatttattagataccgacttattacaaaacgatccagaagatagaaaaataacctctacc
ctatatggtggagatttagaaatgagaattaaacaagagatggttattggtatagcaggt
gtaagagctttaagaaagcttggctataaaccttctgtatggcatatgaatgaaggacat
tcggcttttctgggtttagaaagaataagagaattcgtacaagaatataatttatcattt
tctgaagctgttcaagctgttagagctggaaatatattcacaacacatacaccagttcct
gcaggaaatgatttatttccaatttatctgatagataaatattttggagattattggcca
caattaaaagctactagacaagactttttagatcttggattagaaaagcaaaaaagtgga
gaaagccttttttctatggctatattagctctaaaactctctggaagggcgaacggtgtt
tctaaattacatggaacagtttcaaaaaagttgtggaatcacgtttggccaggaatagaa
tgggtagaagtgcctattacttatgtaaccaacggtgttcatattaattcttggttaaat
ccactattacaagaatcttttaaaaaatatttaggtgaagactggatgctaaaaatagat
gatccagatttatggaccaaaataaacgatattcctaatgaagagttatggaagatccat
atgttactcaaaaaagaattaataaagtttgttcgcgaaagtattaaagcccaaaggatg
agacatggagaaactgtagaacaattagaagaagtagagaatatagggaatgaagaagct
ttaacaataggttttgcaaggagatttgctacatataagcgagcagatttgatatttaaa
gatcctgaaagacttaaaaagattttaaacaatcccgaaagacctgtagaattgatattc
gctggtaaagctcatccagcagacaaaccaggtcaagaattaatgaaaaaaatatatgaa
tattcaagagatccagaatttaaaaataaaataattattctagaaaattatgacatgaat
atggcaagatttttagtttctggtgttgatatttggcttaataatcctagaaggcccctg
gaggcatcaggaacatcagggcaaaaggcaggaatgaatggagcaatcaatttttctgtt
ttagatgggtggtggaatgagggttacaacgggaaaaacggttggactataggtgatgat
agagattatgaaaaccacgaattgcaagacaaaatagacagtgtctctatttataaccaa
cttgaaaaacaaattgttcctttatactatgaaagaggcaatggaaatattccacaagag
tggatagaaaaaatgaaagagtcactaaagagtgtaacctcatttttcaacacatataga
atgcttaaggagtatactcaaaagttgtatatgcctgcaagtgaacaacatagaaatttc
tgttccaacgattttaaagtagttaaagattttacaaaatggttaaatttattgaaagag
aattggaattcaataaaaatacatgtaatgtttgattacgaaaagtctcagatcataaat
gcagaagaagaaatcgagatacaggcagagatttatatgcccggaattggcccagattca
attattgcagaaattgttgtggcctcactacaaaatgggaaaattgaacagcttaaaact
tatgatatgaagcttgttaaagaaattcaaaaagatgcttatttatatactggtaaaata
aagattgaagatagaggagagtatggaataaatgtgagggtaacccccaatcatccttac
atgccacacaaaaattatctaatgggtttagttaaatatcctgaataa

DBGET integrated database retrieval system