KEGG   Desulfobacula toluolica: TOL2_C02940Help
Entry
TOL2_C02940       CDS       T02268                                 

Gene name
glpD
Definition
(GenBank) GlpD: glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dto  Desulfobacula toluolica
Pathway
dto00564  Glycerophospholipid metabolism
dto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dto00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TOL2_C02940 (glpD)
Enzymes [BR:dto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     TOL2_C02940 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like GIDA Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CCK78464
UniProt: K0N2W4
LinkDB All DBs
Position
complement(357857..359416)
Genome map
AA seq 519 aa AA seqDB search
MNRQENIDHIADRSIVWDVIVVGGGATGLGAAVDAASRGYRTLLLEQGDFAQGTSSRSTK
LIHGGVRYLQQGNLALVLESLHERGLLLANAPHLVRHLAFVVPIYEWWEGPFYGIGLKLY
DALAGKLGLGPSRRLSRKKTLEKIPTLEPDGLRGGVVYYDGQFDDARLAISLLRTLEDLG
GNAVNYMPVTGFLKTGGLLCGAMTRDEETGRVFEISGRAVINAAGIFIDSVCRMDDSTAR
PMMAPSQGVHIVLDKGFLPGSSAIMVPHTDDGRLLFAVPWHDRVIIGTTDTPVAGPQVEP
QPFPEEVEFLLSHAGRYLTGHPSRADVKSVFAGIRPLINSRGHNVTASLSRDHRVLVSAS
GLVTVAGGKWTTYRKMGEDAVTMAARVGGLDLKKSCTDTLELHGRPGQAIHDQAFSIYGT
DADAMRQLIKKDPELDFLLHPQLPYRRVEIVWAVRNEMARTVTDVLARRLRALILDAKIS
IRVAPIVASIMAKELVKDLTWESDQVASFEKIAKRYMIN
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacaagagaacattgatcacattgcggacagatccattgtgtgggatgtcatc
gtggtaggcggaggtgcaacgggattgggggctgcagtggacgcagcttcccgaggatac
cgtaccctgcttctggagcagggagattttgcccaggggacttccagccgcagtaccaaa
ttaattcacggcggtgtccgttaccttcaacaaggcaatctggcgctggttctggaatct
ttgcatgaacgcggcctgctgctggccaatgcgccccaccttgtccggcacctggccttt
gtggttcccatatacgaatggtgggaagggccattttacggaattgggctcaaattatat
gatgccctggcaggcaagctgggactggggccgtcccgtcgtttatcccggaagaaaacc
cttgaaaaaatacccacccttgaacccgacgggctgcgcggcggcgttgtttattatgac
gggcagtttgacgatgcccggctggccatctctttattaagaacccttgaagatctcggg
ggtaacgccgtcaattacatgccggtgaccggatttcttaaaaccggcggattactctgc
ggcgccatgacccgggacgaagaaaccggacgggtatttgagatatcaggccgggctgtg
atcaacgccgccgggatattcatcgatagtgtctgccggatggacgattcaacagcccgg
cccatgatggctccgagccaaggtgtccatatcgtcctggacaagggatttcttccggga
agctcggcaatcatggttcctcataccgacgatggccggttgctgtttgccgtaccctgg
catgaccgggtaattatagggacaacggacacaccggttgccggtcctcaagtcgaacct
cagccttttccggaggaggtggaatttttgctttcccacgcgggaagatatctcaccggg
catccctcccgcgctgacgtcaaaagtgtttttgccggtatccgtccgcttatcaactcc
cggggacataatgtgaccgcttctctttcacgggatcacagggttctggtatcagcttca
gggctggttaccgttgccggcggaaaatggaccacataccggaaaatgggtgaagatgcg
gttaccatggccgccagggttgggggattagacctcaaaaagtcctgcacagatacactt
gagcttcacggacggcccgggcaagcaattcatgatcaggctttttcaatatacgggaca
gatgcagatgcgatgcggcaactgatcaaaaaagatcctgaattggattttttgcttcat
ccgcaattgccctacaggcgggttgaaattgtctgggcggttcgcaatgaaatggcgcga
accgtaaccgatgtgttggcacgacggctccgggcgcttattctggatgcaaagatcagc
atcagggttgcccctattgttgcgtcaatcatggcaaaagagctggtaaaggatttgacg
tgggagtctgaccaggtggcgtcatttgaaaaaatcgccaagaggtatatgataaattaa

DBGET integrated database retrieval system