KEGG   Candidatus Desulfovibrio trichonymphae: RSDT_0712Help
Entry
RSDT_0712         CDS       T05578                                 

Gene name
rnb
Definition
(GenBank) putative exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
dtr  Candidatus Desulfovibrio trichonymphae
Brite
KEGG Orthology (KO) [BR:dtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dtr03016]
    RSDT_0712 (rnb)
Enzymes [BR:dtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     RSDT_0712 (rnb)
Transfer RNA biogenesis [BR:dtr03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    RSDT_0712 (rnb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: BAV92224
UniProt: A0A1J1E443
LinkDB All DBs
Position
953852..955966
Genome map
AA seq 704 aa AA seqDB search
MPDCVRYPAPGCIVEYMEGNAPQIAMITEESGGHLRLLLPNRREMRLNAARILPWIGPMH
ASGMGREDAVRILESHKKKREALALAVAPLEVWDIAQGEVPQAPARWFAEFFTAEPDADA
VAACGRALLACKSHFRFQPPAFQIFPAETVEKRLAEQREKQVREALVTGGAAFFRLLWEA
ACKKCVLPLSGTSGAECGEWPSPEVAERLKALLRARMVDPESQENENLWRMLVKTLPDVP
HLPLQLLTAWGELPEHYNFWLDRAGYAPGDDWWLPHAGEANALVLTTQNCDAPLCDIPFL
SIDSASTRDVDDAFFVEPNGTGCTLTLALACPALFWPFESPLNKAVLYRGTSIYLPEGTC
HMLPEMMATAAFSLTAGQMRPALCMRIQVNGAGNADDCELFIARVRLAANLCYADCQAVF
DADRKQAPLPDNAARPYADQLRHGLALARLRQQARIAAGAVIMDRVEPVLHLHGDGANTT
VEMEMPAPARDAQNLVAELMILASASAANWACAHSLSMLHRTQDVALPKEYAGIWTLPED
LTRIMRSLASSCLEVQARPHAALAVARYTPVTSPLRRYTDLVNEAQVTHFLQTGTPLWSE
AGLVDILGALSPVLNAAGQAQRFRPRYWKLLYFRQKGDKVWWHGVITEENDAVVNVNLPD
QGLFVRGRRLLFDERAYPGMPVAVRLGKIHPLYNEIQILEAAAQ
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgcctgattgcgtgcgataccctgcaccgggctgtattgtggaatacatggagggcaat
gccccccagatcgccatgatcacagaagaatccggagggcatctgcgtctgttgctgccc
aaccggcgcgaaatgcgcctgaacgccgcgcgcattctgccctggatcggccccatgcac
gcgtccggcatgggcagagaagacgctgtgcgcattctggagtcgcataaaaaaaaaagg
gaagccctggcgcttgccgtcgcgccgctcgaagtatgggacatcgcccaaggggaggtc
ccccaggcgccggcgcgctggtttgctgaattcttcaccgccgagccggacgcggacgct
gtagccgcctgcggccgcgcgctgcttgcctgtaaaagccattttcgttttcagccgccc
gcttttcagatttttcccgctgaaacagtggaaaaacgccttgccgagcagcgcgagaaa
caagtgcgtgaggcccttgtcacgggcggcgcggcattttttcgtctgctgtgggaggcc
gcctgcaaaaaatgtgttctgccgctgtcaggaacgagcggcgcggaatgcggtgaatgg
ccctcgcctgaagtggcagaacggctcaaagccctgctgcgcgccaggatggttgatccg
gaaagtcaggagaacgaaaacctctggcgcatgctggtcaaaaccctgccggacgtgccg
catctgcccctgcaattgctcacggcgtggggcgagttgccggaacattataacttctgg
ctggacagggccggttacgcacccggcgacgactggtggctcccccacgccggggaagca
aacgcccttgtgctcactacgcaaaactgcgatgcacccttgtgcgatataccttttctg
agcatagacagcgcaagcacccgtgatgtggacgacgctttttttgtggaacccaacggc
accggttgtacgttgacgctggccttggcctgtccggccctgttctggccttttgaaagc
cctctcaacaaagccgtgctgtaccgcggcacaagcatctatttgccggagggcacatgc
cacatgctgccggaaatgatggcgacagcggctttttcgctgacagccgggcaaatgcgc
cctgcgctgtgcatgcgcatacaggtgaatggagcgggcaacgcggacgattgcgagctt
tttattgccagggtccggcttgcggcaaacctgtgttacgcggactgtcaggccgtattt
gacgccgatcgaaaacaggctcctctgccggacaatgccgcaaggccttacgccgaccaa
ttgcgtcatggactggcgctcgcccgtttacggcaacaggcgcgcattgcagcgggcgcc
gttattatggacagggtcgagcccgtgctgcatttgcacggcgatggcgcgaacacgacc
gtggaaatggaaatgccggcccccgcccgtgacgcacagaaccttgtcgctgaattgatg
attctggccagcgcatcagcggcgaactgggcatgcgcgcacagcctgtccatgctgcac
cgcacgcaggacgtggccctgccgaaagaatacgccgggatatggacactgccggaagac
ctgacccgcattatgcgctcgctcgcctcctcctgcctggaagtacaggctcggccccat
gccgcccttgcagttgcgcgctatacgcctgtcacctcgcccctgcgccgctatacagat
cttgtcaacgaggcgcaagtgacgcattttctgcaaacaggcacacccttatggagcgag
gctggtcttgtggacattctcggcgcgttatcccccgttctgaacgcggcagggcaggcg
caacgtttccgcccgcgctactggaagctgctctatttccgccagaagggggacaaagtc
tggtggcacggcgttattaccgaagaaaacgacgccgttgtcaacgtgaacctgccggat
caggggctgtttgtgcgcggcagacgccttctttttgacgaaagggcatatccgggcatg
cccgtcgcggtgcgcctggggaaaatacatccgctctataatgaaatacaaatattggaa
gcggccgcgcaatag

DBGET integrated database retrieval system