KEGG   Delftia tsuruhatensis: BI380_01285Help
Entry
BI380_01285       CDS       T04496                                 

Definition
(GenBank) 2-aminobenzoate-CoA ligase
  KO
K08295  2-aminobenzoate-CoA ligase [EC:6.2.1.32]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00627  Aminobenzoate degradation
dts01120  Microbial metabolism in diverse environments
dts01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BI380_01285
Enzymes [BR:dts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.32  anthranilate---CoA ligase
     BI380_01285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AOV00083
UniProt: A0A1D8IU87
LinkDB All DBs
Position
263036..264676
Genome map
AA seq 546 aa AA seqDB search
MQASAHIDTFARDNLPPPDQWPEFLLDGPDVAYPERLNCAAELVDAMVARGQGGRVALRW
RQGADQAAMTYAELQALTNRIAHVLVDDLQLVPGNRLLLRGPNNAMMAASWLAAIKAGLV
TVPTMPLLRAKELQQIIAKARVQAVLCDMRLKDEVQLCLQPGHEHHCPDLSRVLYFNDGA
ADALDALAAAKPDTFDCCDTAADDVCLIAFTSGTTGAPKGCMHFHRDVLAMCDLFPRHVI
RPGPDDIFCGTPPLAFTFGLGGLLCFPLRVGASTVLAEKLTPEGLLQLVQDFRATIVFTA
PTFYRQMAAQAARFDLSSLRKSVSAGEALPDATRQLWKQATGIEMIDGIGGTELIHVFVS
SPPEEVRAGAIGKVVPGYVAQVVDDDMQPVPDGTPGRLAIKGPTGCRYLADERQKRFVQN
GWNLPGDTFVRDADGYLFYQARNDDMIISAGYNIAGPEVEDALLRHEAVAECGVIGAADD
ERGQVVKAFVVLKPGFAAGDDMAATLQAFVKASIAPYKYPRAIVFVPALPRTETGKLQRF
VLRKMP
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctccgcccacatcgatactttcgcccgggacaacctgccgccgcccgaccaa
tggcccgagttcctgctcgacgggccggacgtggcctatcccgaacgcctgaactgcgcg
gccgaactggtcgatgccatggtggcgcgcggccagggcggccgcgttgccctgcgctgg
aggcagggcgcggaccaggccgccatgacctatgccgaactgcaggcgctgaccaaccgc
atcgcccatgtgctggtggacgacctgcagctggtgcccggcaaccggctgctgctgcgc
ggccccaacaacgccatgatggccgcttcctggctggccgccatcaaggccgggctggtg
acggtgcccaccatgccgctgctgcgtgccaaggagctgcagcagatcatcgccaaggcc
cgggtgcaggccgtgctgtgcgatatgcgcctcaaggacgaagtgcagctgtgtctgcag
cccggccatgaacaccattgcccggacctttcgcgcgtgctgtatttcaacgacggtgcg
gccgatgcgctggacgccctggccgcagccaagcccgacaccttcgactgctgcgacacg
gcggcagacgatgtctgcctgatcgccttcaccagcggcaccacgggcgcgcccaagggc
tgcatgcatttccaccgcgacgtgctggccatgtgcgacctgttcccgcgccatgtgatc
cggccgggcccggacgacatcttctgcggcacgccgccactggccttcacctttggcctg
ggcgggctgctgtgctttccgctgcgcgtgggcgccagcaccgtgctggccgaaaagctc
acgcccgaagggctgctgcagctggtgcaggatttccgcgccaccatcgtcttcaccgca
cccaccttctaccggcagatggcggcgcaggcagcgcgcttcgacctgtcgtcactcagg
aaaagcgtctcggccggcgaggccctgccggacgccacgcgccagctgtggaagcaggcc
acgggcatcgagatgatcgacggcatcggcggcaccgagctgatccacgtctttgtgtcc
agcccgcccgaggaggtgcgcgcgggcgccatcggcaaggtcgtgcccggctatgtggcc
caggtggtggatgacgacatgcagcccgtgcccgacggcacgcccggccgcctggccatc
aagggaccgaccggctgccggtatcttgccgacgagcgccagaagcgctttgtgcaaaac
ggctggaacctgcccggcgatacctttgtgcgcgacgccgacggctatctgttctaccag
gcgcgcaatgacgacatgatcatctcggccggctacaacatcgccggccccgaggtggag
gacgcactgctgcgccacgaggccgtggccgaatgcggcgtgatcggcgcggcagacgac
gagcgcggccaggtggtcaaggcctttgtggtgctcaagcccggctttgcggccggcgac
gacatggccgccacgctgcaggccttcgtcaaggccagcattgcgccctacaagtacccg
cgcgccattgtcttcgtgccggccctgccgcgcaccgagaccggcaagctgcagcgcttc
gtgctgcgcaagatgccgtga

DBGET integrated database retrieval system