KEGG   Delftia tsuruhatensis: BI380_03290Help
Entry
BI380_03290       CDS       T04496                                 

Definition
(GenBank) hypothetical protein
Organism
dts  Delftia tsuruhatensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPD37 LPD38
Motif
Other DBs
NCBI-ProteinID: AOV05785
UniProt: A0A1D8JAN7
LinkDB All DBs
Position
681198..686360
Genome map
AA seq 1720 aa AA seqDB search
MRLHGTSRPLPEGGPTNDGVYRGNVLNIYGQGFYTTDAADIAAGYTRKGQGGEPTLYEIA
EHSPVRLYDMNAPMEPEVQSMAKRVLDDLARDENTETGERITTLAQLFDEARAESRYEGV
SADELQERFDGIRYNLEDMGYRGFAHVGGGKTGNQAHKVNIYWYPEDDLSVTRSELSRFE
EGAEQPAGVPFKRAESSVAPTMTADLAQELLRIAGGAAPAGARHAPQAPMARVQKVVDEV
RQAWANAPRINVVFDLQDPRVPQEARDTERLQAAEGAEGVPKGFYFDGEVYLVASQLATP
EEAARVLYHEALGHHGLRGAFGEKLDAVLDQLIVARPREVRAKLQEYGELDDLVGRRYAA
EEVLAEMAETQPQLGFVRRAVAAIRAWLRTHVPALRDLAMTDAEIIRDFILPARRWVERG
AAAAASAVSARPKYSLDSGAGRRALQELSQLDDLFTLPKSKQTDLKAIAKEHAPDIEVSR
PVSIAGRQEYTLKMPDGKKATLSVRQPNPYGEQVYDMLYTAEGMEAVAGRPGENPEDVPP
TTDVWLDVSKLSQGDSGAMAYSIAATFAHNTDSIFIGDPHGLSKTALRRRLEQMLSSALK
FGTTRHLAPHPDQVRGGHGVPGLRWIYGDDVGNVERMIAASVAATDNAFPTSNQIEYDAD
SGSFRLSNSGKQLSRQQLAGLVGQSIRARRAVAGSGPAEAEAGWRTVARAAVWRALLRGE
GSSGEGNRRGRGAVLGRFAERHAQVLGDPSPKLRVFYSRGPAAGAATPEPSKGRLGRLQD
KVADLTGYRSVDDFLYSWQDKFIDLKRIQEHIKALNGTVTETNDAYRGEELYHKRVAKRA
GNFLRDEVRPLLKRMNEAKVAIEELERFLHARHAPEANRVMAERNPGSQQLQAQRDAAGK
TVEDLRRQLQRAQARGMATGPVQKALGQALNDKDRWDHAEAFDGTEEERLSLSGMSDAEA
KAIMNGYSPERRQVLDELAVRVDRMNDGTLKTLESYGLMDQATLSAWRKTYQHYVPLHRD
EAHPDSKAHPIGQGFSTKGDASKRRTGSNERVTNILSHIVMQREAALTRGEKNNVVKRMY
LLAAQNPDKQLWSLELPKKKALDTDTGLVKTMVDQGAKARDNVVTVRIGGKDRYIVFNEH
NEKAVRLAVAMKNLDAMELDRFTRIAAWITRWFASVNTQYNPVFGVMNLARDLQGAMLQL
STTPLAGKQAEVFRNIRRNTRAIYKELRRERKEEGAPTGQWAQLWEQLQLDGGTTGYRDL
HADPKDRAKALQKALDQAGQGTSVVAGGRALLAWLSDFNETLEATTRLGVYKAALDQGIS
RQEAASIAKNITVNFNRKGRNTSVVGTHFAFLNAAIQGNKRMLETLAGPAGRKIMMGGVA
LGMASAMAGYLMMGGGDGADDEWKKIPEFVKERAIIIPLGRQDYVAIPLPLGFHVFPNIG
RTIVEMAVHDDPTKSRMGHVLDMAVLALDAYNPLGGSADLGQMASPTWFDPALALARNKD
WTGREIYREDRNSNDPTPGVSRVKDSTAEPYRWMATFANAVTGGNEWRPGAASPTPEAIE
YLVEQITGGVGRELNKAVAMATSAFTGEELAPHQVVLAGRLYGNTRGANGQSNAYYENLK
RINVSENEFKARVQRGEDADAVLADVPLARAHDAAKALDKKISDLRKFRRSVQASEAADK
RDQVRAINQEIELSMRLLNHEVHRTLGSAKVSQSWEGKRE
NT seq 5163 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcctgcatggcaccagccgcccgctgcccgaaggcggtcctaccaacgatggcgtc
taccgcggcaacgtcctcaacatctacggccagggcttctacaccacagacgccgccgac
atcgccgccggctacacccgcaaagggcagggcggcgagccgacgctgtatgagattgcc
gagcactcccctgtccgtctgtatgacatgaatgctccgatggagcctgaagtgcagtcc
atggccaagcgcgtcctggacgacttggcccgcgatgaaaacacggaaacgggcgagcgc
atcaccacgctggcccagctgttcgatgaagcgcgcgccgagtctcgctacgaaggcgtg
agtgcggacgagctgcaggagcgcttcgatggcattcgctacaacttggaggacatgggc
tatcgcgggtttgcgcatgtgggcggcggaaaaaccggcaaccaggcccacaaggtgaac
atctactggtatcccgaggatgatttgtccgtcacgcgcagcgagctgtcccgctttgag
gaaggggctgagcagccggcgggagtaccgttcaagcgcgcggagagttccgtggcgccc
accatgacggccgacctggcgcaggaactgctgcgcatcgctggtggcgcggcgccggcg
ggcgcgcgccatgcgccccaggcacccatggcgcgcgtgcagaaggtcgtggacgaagtg
cgccaggcctgggccaatgcgccgcgcatcaacgtggtgttcgacctgcaggacccgcgc
gtgccccaggaggcgcgcgacacggagcgactgcaggcggccgagggcgcggagggcgtg
cccaagggcttctacttcgatggcgaggtctacctggttgcgagccagctggccacgccg
gaggaagcggctcgcgtgctgtaccacgaggcgctgggccaccacggcctgcgcggcgcc
ttcggcgagaagctggatgcggtgctggaccagctcatcgtggcccgcccccgcgaggtg
cgcgccaaactgcaggagtatggcgagctggacgacctggtgggccggcgctacgcggcc
gaggaggtgctggccgagatggccgagacacagccgcagctcggctttgtccgccgcgcc
gtcgccgccatccgcgcctggctgcgcacccatgtgcccgcgctgcgcgacctggccatg
acggacgcggagatcatccgcgacttcatcctgcctgcgcgccgctgggtggagcgtggt
gcggcggccgctgcatcggcggtgtcggcacggcccaagtacagcctggacagcggcgct
ggccggcgggcgctgcaggagctgtcccagctggacgacttgttcaccttgccaaagtcg
aagcaaacggatctgaaggccatcgccaaggagcacgctccggacatcgaggtgagcagg
ccggtgagcattgccggtcggcaggaatacacgttgaagatgccggatggcaagaaggcc
acgctgtcggtgcgccagcccaatccctacggagagcaggtctacgacatgctctacacg
gcggagggcatggaggccgtggccggccggccaggcgagaacccggaggatgtgcctcct
accacggacgtgtggctggatgtgtccaagctgtcccagggggactcgggtgccatggcg
tacagcatcgccgccaccttcgcgcacaacacggacagcatcttcatcggcgatcctcac
gggctgagcaagaccgcgctgcgtcgccggctggagcagatgctgtccagcgccttgaag
ttcggcaccacgcgccacctggcgccacaccctgaccaggtgcgcggtggtcacggagtg
ccgggcctgcgctggatctacggggatgacgtcggcaatgtggagcgcatgattgcggcg
agcgtggctgccacggataatgcgttcccaacctccaaccagattgaatatgacgcagac
agtggatcgttccgactttccaattccgggaagcaactatcaagacagcaactggctggc
ttggttggacaatccatccgagcaagacgtgcagtggctggaagcggaccggcagaagcg
gaagctggctggcgaacagttgcgcgagcggctgtctggcgtgcccttctacgcggagag
ggcagctcgggtgaaggcaatcgacggggacgaggcgctgtactgggaaggtttgctgag
cggcacgcacaagttctaggcgaccccagccccaagctgcgcgttttctacagccgcggc
cccgctgccggcgcggccacgccggaaccctccaagggcaggctgggccgtctgcaggac
aaggtggcggacctcaccggctaccgctcggtggatgacttcctgtattcctggcaggac
aagttcatcgatctcaagcgcatccaggaacacatcaaggccctgaacggtaccgtcacc
gagacgaacgacgcctaccggggcgaggagctgtaccacaagcgcgtggccaagcgcgcc
ggcaacttcttgcgcgatgaggtgcgaccactgctcaagcgcatgaatgaggccaaggtg
gccatcgaggagctggagcgctttctgcacgcccggcacgcgcccgaggccaaccgcgtc
atggccgagcgcaaccccggctcccagcagttgcaggcccagcgcgatgccgctggcaag
acggtggaagatctacgccgccagctgcagcgtgcccaggcccggggcatggccaccggc
ccggtgcagaaggcgctgggccaggccctcaacgacaaggaccgctgggaccacgccgag
gctttcgatggcaccgaggaggagcgcctgtccctgtcgggcatgagcgatgccgaggcc
aaggcgatcatgaacggctacagccccgagcggcggcaggtgctggacgagttggccgtg
cgcgtggaccgcatgaacgatggcaccctgaagacgctggagagctacgggctcatggac
caagccacgctgtcggcctggcgcaagacctatcagcactacgtgccgctgcaccgcgac
gaagcccacccggacagcaaggcccatcccatcggccagggtttcagcacgaagggcgat
gcatcgaagaggcgcacgggttcgaacgagcgcgtgaccaacatcctgagccacatcgtc
atgcagcgagaggcggcactgacgcgcggcgaaaagaacaacgtggtcaaacgcatgtac
ctgctggcggcgcagaacccggacaaacagctgtggagcctggaactgcccaagaagaag
gcactggacacggatacgggcctggtcaagaccatggtggatcagggcgccaaggcgcgc
gacaacgtggtgacggtgcgcattggcggcaaggaccggtacattgtcttcaacgagcac
aacgagaaggccgtgcgcctggctgtggccatgaagaatctggatgccatggaactggac
cgcttcacgcggattgctgcctggatcacgcgctggttcgcatcggtgaacactcagtac
aaccctgtgttcggggtcatgaacctggcgcgcgacctgcagggcgccatgctgcagctg
tccactacgcccctggccggcaaacaggcagaggtgttccgcaacatccgccggaacacg
cgcgccatctacaaggaactgcgccgcgagcggaaggaagagggcgcacccactggccaa
tgggcgcagctgtgggagcaactgcagctcgatggcggcacgacaggctaccgcgatctg
catgccgatcccaaggaccgtgccaaggcactgcagaaggcgctggaccaggctggccag
ggcacatcggttgtcgccggcggtcgcgcgctgctggcttggctgtcggacttcaatgaa
accctggaggccacaacgcgccttggcgtctacaaggctgccctggaccagggcatcagc
cgccaggaggccgcgagtatcgccaagaacatcacggtgaacttcaaccggaagggccgc
aacacctccgtggtggggacgcattttgcgttcctgaatgcggcgatccagggcaacaag
cgcatgctggagacgctggcggggcctgccgggcgcaagatcatgatgggtggcgtggcc
ctgggcatggcgtcggccatggcggggtatttgatgatgggcggcggcgatggtgccgac
gacgaatggaagaagatccccgagtttgtgaaggagcgggcgatcatcatcccgctgggc
aggcaggactatgtagcaatcccgctgccgctggggttccatgtgttccccaacatcggc
cgcaccattgtggagatggctgtgcatgacgacccgaccaagagccgaatggggcacgtc
ctggacatggccgtgctggccctcgatgcctacaacccgctgggcgggtctgctgatctg
gggcagatggcgtcgcccacctggtttgatcccgcgctggccctggctcgcaacaaggac
tggacaggacgggagatctaccgagaggaccggaattcaaacgacccgacgccgggcgtg
agccgggtgaaggattcgactgcggagccttaccgctggatggccacctttgccaatgcc
gtgacgggcggcaacgaatggcggcccggcgctgccagcccgacgccagaggccatcgag
tacttggtggaacagatcactggtggcgtgggccgcgagttgaacaaggccgtggccatg
gccacgtccgccttcactggcgaggaactggcgccgcaccaggttgttctggcaggccgg
ctctatgggaacacgcgcggcgccaacggccagagcaacgcctattacgagaacctcaag
cgaatcaatgtcagcgagaacgagttcaaggcccgcgttcagcgcggcgaggatgcagat
gcagtgctggctgacgttcctctggccagggcccatgacgcagccaaggcactggacaag
aagatttcggatctccgcaagttccgccgcagcgtacaggcgagcgaggctgcggacaag
cgcgatcaggtcagggctatcaatcaggagattgagctgtccatgcgtctgctgaatcac
gaagtacaccgaacgctagggtcagcgaaagtctctcaatcgtgggaaggcaaacgcgaa
tga

DBGET integrated database retrieval system