KEGG   Delftia tsuruhatensis: BI380_03455Help
Entry
BI380_03455       CDS       T04496                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00020  Citrate cycle (TCA cycle)
dts00310  Lysine degradation
dts00380  Tryptophan metabolism
dts01100  Metabolic pathways
dts01110  Biosynthesis of secondary metabolites
dts01120  Microbial metabolism in diverse environments
dts01130  Biosynthesis of antibiotics
dts01200  Carbon metabolism
Module
dts_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dts_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BI380_03455
  09105 Amino acid metabolism
   00310 Lysine degradation
    BI380_03455
   00380 Tryptophan metabolism
    BI380_03455
Enzymes [BR:dts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BI380_03455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF1631
Motif
Other DBs
NCBI-ProteinID: AOV00477
UniProt: A0A1D8IVG2
LinkDB All DBs
Position
725851..727113
Genome map
AA seq 420 aa AA seqDB search
MAIVEVKVPQLSESIAEATMLTWKKKAGEAVAVDEILIEIETDKVVLEVPAPAAGVLAEI
VQGDGATVVAEQLIAKIDTEGVAGVAAAAPAAAPAAAAAPAAAPAAAAATGGSKGDVAMP
AAAKLLAENNLSAAGVAGSGKDGRVTKGDALAAIKGGVQSTAAVIPTGVPTKALPQVSAP
SAKEDLSGRPEQRVPMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMDLRKKFQDAFT
KEHGTKLGFMSFFVKAAVHALKKYPVLNASVDGNDIVYHGYFDIGIAVGSPRGLVVPILR
NADQMSFADIEKKIAEFGKKAAEGKLGIEEMTGGTFSISNGGTFGSMMSTPIINPPQSAI
LGVHATKDRAMVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPSRLLFDL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgaagtcaaagttccccagctgtccgagtccatcgctgaggccaccatg
ctgacctggaagaagaaggccggcgaagcggttgcagtcgatgagatcctcatcgagatc
gaaaccgacaaggtcgtgctcgaagtgcccgcgcccgccgctggcgtgctggccgagatc
gtgcaaggtgacggcgccaccgtggtggccgagcaactgatcgccaagatcgacaccgaa
ggcgtggccggtgtggccgctgccgctcctgcagccgcccccgccgctgcagccgctccc
gctgcagcgcccgcagccgcggccgccaccggtggcagcaagggtgatgtcgccatgccc
gccgctgccaagctgctggccgaaaacaacctgtcggccgccggcgtggctggctccggc
aaggatggccgcgtgaccaagggtgacgcgctggccgccatcaagggcggcgtgcagtcc
accgctgccgtcattcccaccggcgtgcccaccaaggcgctgccccaggtgtcggctccg
tccgccaaggaagacctcagcggccgtcccgagcagcgcgtgcccatgagccgcctgcgt
gcccgcgtggccgagcgtctgctgcagtcgcagtccaccaacgccatcctgaccacgttc
aatgaagtgaacatggccccggtgatggatctgcgcaagaagttccaggacgccttcacc
aaggaacacggcaccaagctgggcttcatgtccttcttcgtcaaggcggccgtgcacgcc
ctgaagaagtacccggtgctcaacgcatccgtggacggcaacgacatcgtctaccacggc
tacttcgacatcggtatcgccgtgggttcgccccgtggcctggtggtgcccatcctgcgc
aatgcagaccagatgagcttcgccgacatcgaaaagaagattgccgaattcggcaagaag
gctgccgaaggcaagctgggcattgaagaaatgaccggcggcaccttctccatctccaat
ggcggcaccttcggctcgatgatgtccacccccatcatcaacccgccccagtcggccatc
ctgggcgtgcacgccaccaaggaccgtgccatggtcgagaacggccaggtcgtggtgcgc
ccgatgaactatctggccatgtcctatgaccaccgcatcatcgacggccgcgaagccgtg
ctgggcctggtggccatgaaggacgcgctggaagatccttcgcgcctgctgttcgacctg
taa

DBGET integrated database retrieval system