KEGG   Delftia tsuruhatensis: BI380_04130Help
Entry
BI380_04130       CDS       T04496                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dts  Delftia tsuruhatensis
Brite
Enzymes [BR:dts01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BI380_04130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2683 DUF4646
Motif
Other DBs
NCBI-ProteinID: AOV00599
UniProt: A0A072T4G4
LinkDB All DBs
Position
861303..861884
Genome map
AA seq 193 aa AA seqDB search
MEHTLPPLPYAIDALAPHYSQETLEYHHGKHHNAYVVNLNNLQKGTEFESMTLEEIVKKS
SGGIYNNAAQIWNHTFFWNCMAPNGGGEPTGALADAINKKWGSYAAFKEAFVKSAVGNFG
SGWTWLVKKADGSVDIVNTGAAGTPLTTQDKALLTVDVWEHAYYIDYRNLRPKFVETFLD
KLVNWKFAEQNFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaacataccttgccccctctgccctatgcgattgacgcgctggcaccccactacagc
caggaaacgctggagtaccaccatggcaagcaccacaacgcctatgtggtgaacctgaac
aatctgcaaaagggcaccgaattcgaaagcatgaccctggaagagatcgtcaagaagtct
tccggcggcatctacaacaacgcagcccagatctggaaccataccttcttctggaactgc
atggcccccaacggtggcggcgagcccaccggcgccctggctgacgccatcaacaagaag
tggggcagctatgccgccttcaaggaagccttcgtgaagtcggccgtgggcaacttcggc
tccggctggacctggctggtgaagaaggccgacggttcggtggacatcgtcaacaccggc
gccgccggcacgcccctgaccacgcaagacaaggccctgctgaccgtggacgtctgggag
cacgcctactacatcgactaccgcaacctgcgtcccaagttcgtcgagaccttcctcgac
aagctggtgaactggaagtttgccgagcagaacttcgcctga

DBGET integrated database retrieval system