KEGG   Delftia tsuruhatensis: BI380_05690Help
Entry
BI380_05690       CDS       T04496                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dts  Delftia tsuruhatensis
Brite
Enzymes [BR:dts01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BI380_05690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AOV05818
UniProt: A0A1D8JAV8
LinkDB All DBs
Position
1256839..1257450
Genome map
AA seq 203 aa AA seqDB search
MRLNASPSTPSTAVKLLMAAGMVLALGACGSQAKPPATAAASTPAAVTAAPAARNVAMAQ
LQPTQGSKVSGSLQFTAQADGSVRVQGSVQGLAPNSEHGFHVHEKGDCSSPDGLSAGGHF
NPTGHAHGRFDSAVHHAGDLPSLRSDAQGMASIDFVSRGLALDQSPNSVVGRGLIVHKDP
DDYTTQPTGNSGARLACAVITRG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgaacgcttccccctccaccccgtccaccgccgtgaagctgctgatggcagcc
ggcatggtgctggcccttggggcctgcggcagccaggccaagcctcctgccacagccgcg
gcgtccaccccggcagccgtcaccgcagcccctgccgcccgcaacgtggccatggcccag
ctgcagcccacgcaaggcagcaaggtcagcggcagcctgcagttcactgcccaggccgat
gggagcgtgcgcgttcagggctcggttcaggggctggcgcccaacagcgagcatggcttt
catgtccatgagaaaggcgattgctccagccctgatggcctgagcgcgggcggccatttc
aaccccacaggccacgcccatggccgcttcgattccgctgtccaccacgcaggggatctg
cccagtctgcggtcagacgcgcaaggcatggccagcatagatttcgtttcgcgcggcctg
gcactggatcagagtcccaacagcgtggtgggccgcggcctgatcgtgcacaaggaccct
gacgactacaccacgcagcccaccggcaattcgggggcgcgcctggcctgtgcggtgatc
acgcgcggatga

DBGET integrated database retrieval system