KEGG   Delftia tsuruhatensis: BI380_08290Help
Entry
BI380_08290       CDS       T04496                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00290  Valine, leucine and isoleucine biosynthesis
dts00770  Pantothenate and CoA biosynthesis
dts01100  Metabolic pathways
dts01110  Biosynthesis of secondary metabolites
dts01130  Biosynthesis of antibiotics
dts01210  2-Oxocarboxylic acid metabolism
dts01230  Biosynthesis of amino acids
Module
dts_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
dts_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BI380_08290
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BI380_08290
Enzymes [BR:dts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     BI380_08290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AOV01356
UniProt: A0A1D8IY51
LinkDB All DBs
Position
1828356..1830050
Genome map
AA seq 564 aa AA seqDB search
MTPPNQINRRSAHITEGKARAANRSMFYGMGYKEEDFKKPMVGVANGHSTITPCNSGLQR
LADAAIAGIEEAGGNAQVFGTPTISDGMSMGTEGMKYSLVSREVIADCIETCVGGQWMDG
VLVVGGCDKNMPGGMMGMLRANVPAIYVYGGTILPGRWKGRDLNIVSVFEAVGENAAGKI
SDQELKDIEQHAIPGTGSCGGMYTANTMSSAFEALGMSLPYSSTMANPHDEKENSAKESA
RVLIEAIKMDLKPRDIVTRKSIENAVSVIMATGGSTNAVLHFLAIAHAAGVPWSIDDFER
IRQRVPVLCDLKPSGRYLAVDLHQAGGIPQVMKILLNAGLLHGDCITISGQTIAETLAGV
PDEPPNPQVIRPLSDALYPQGHLAILKGNLSPEGAVAKITGLKNPVITGPARVFDDEQSA
LAAILDGRIQAGDVMVLRYLGPKGGPGMPEMLAPTGALIGAGLGESVGLITDGRFSGGTW
GMVVGHVAPEAAVGGTIALVHEGDSITIDAHALRLQLNVPEDVLAQRRAAWKAPAPRYTR
GVQAKFAFNASSASSGAVLDNFAI
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgccgaaccagatcaaccgccgaagcgcccacatcaccgaaggcaaggcgcgc
gcagccaaccgctccatgttctacggcatgggctacaaggaagaggatttcaagaagccc
atggtcggcgtggccaacggccacagcacgatcacgccgtgcaactccggcctgcaaagg
ctggcggacgcggccatcgcaggcatcgaggaagccggcggcaacgcgcaggtgttcggc
acgccgaccatctcggacggcatgtccatgggcacggaaggcatgaagtactcgctggtc
agccgcgaggtgatcgccgactgcatagagacctgcgtgggcggccagtggatggacggc
gtgctggtggtcggcggctgcgacaagaacatgccgggcggcatgatgggcatgctgcgc
gccaatgtgccggccatctatgtctacggcggcaccatcctgcccggcaggtggaaaggc
cgggacctgaacatcgtcagcgtgttcgaggccgtcggcgagaacgccgcgggaaagatc
agcgaccaggagctcaaggacatagagcagcacgccatccccggcacgggctcgtgcggc
ggcatgtacaccgccaacaccatgtccagcgcgttcgaggcgctgggcatgagcctgccc
tactcctccaccatggccaatccccatgatgaaaaggaaaactcggccaaggaatccgcc
agggtgctgatcgaggccatcaagatggacctcaagccgcgcgatatcgtgacgcgcaag
tccatcgaaaacgcggtctcggtgatcatggcgaccggaggctccaccaatgccgtgctg
cactttctcgcgatcgcccatgcggccggcgtgccctggtccatcgacgacttcgagcgc
atccgccagcgggtgccggtgctgtgcgatctcaagcccagcggcagatacctggcggtg
gacctgcatcaggcgggcggcatcccgcaggtgatgaagatcctgctgaatgcgggcctg
ctgcacggcgactgcatcaccatctcgggccagaccatcgccgagaccctggccggcgtg
cctgacgaaccgcccaacccccaggtcatccgccccctctcggatgcgctctacccgcag
ggccacctggccatcctcaagggcaacctgagtccggaaggtgcggtggccaagatcacg
ggcctgaagaacccggtcatcaccggcccggcacgcgtgttcgacgatgagcaatcggca
ctggcggccatcctcgacggcaggatacaggccggcgacgtgatggtgctgcgctacctg
ggccccaagggcggccccggcatgccggaaatgctggcacccacgggcgccctgatcggc
gccggcctgggcgagagcgtgggcctgatcaccgatggccgcttctccggcggcacctgg
ggcatggtggtcggccacgtggcgccggaagcggccgtgggcggcaccatcgcgctggtg
cacgagggcgactcgatcaccatcgacgcgcacgcattgcggctgcagctgaacgtgccc
gaagacgtactcgcccagcgccgcgcggcatggaaggcccccgcgccccgctacacgcgg
ggcgtgcaggccaagttcgctttcaacgcatcgagcgccagctcgggcgcggtgctggac
aacttcgccatctga

DBGET integrated database retrieval system