KEGG   Delftia tsuruhatensis: BI380_17070Help
Entry
BI380_17070       CDS       T04496                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00473  D-Alanine metabolism
dts00550  Peptidoglycan biosynthesis
dts01100  Metabolic pathways
dts01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BI380_17070
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BI380_17070
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BI380_17070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dts01011]
    BI380_17070
Enzymes [BR:dts01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BI380_17070
Peptidoglycan biosynthesis and degradation proteins [BR:dts01011]
 Precursor biosynthesis
  Amino acid ligase
   BI380_17070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 RimK CPSase_L_D2 GARS_A TTL ATPgrasp_ST ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AOV02931
UniProt: A0A1D8J2G3
LinkDB All DBs
Position
complement(3665350..3666327)
Genome map
AA seq 325 aa AA seqDB search
MSSFGTQIDVKALGKVAVLLGGRSAEREVSLMSGTGVLKALLSQGVDAHAFDPAERDLGE
LKKDGFDRCFIALHGRYGEDGTVQGALELLGIPYTGPGVMASSIAMDKIMTKRIWRFEGL
PTPDWRLVASADETRAALQALGAPMIVKPSREGSTIGLTKVWTAEECEQAYVLASRYDPE
VLCEEFIEGDETTCPVLGTGEGAHALPVIRIVAPEGNYDYQNKYFTDDTQYHCPSGLPAE
EEAEIRRIVVRAFRTLGCRGWSRADIMIRASDRKPFLLEINTSPGMTGHSLVPMSARAIG
VSYENLCLGILASAALDAQPEQEHA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcttcggcacccagatcgatgtcaaggccctgggcaaggtggccgtgctgttg
ggcggccgctcggccgagcgcgaggtctcgctgatgtcgggcacgggcgtgctcaaggcc
ctgctgtcgcagggcgtggatgcccatgccttcgaccccgccgagcgggacctgggcgag
ttgaagaaggacggtttcgaccgctgcttcatcgcgctgcatggccgctacggtgaggac
ggcacggtgcagggcgcgctggagctgctgggcatcccgtacacgggccccggcgtgatg
gcctccagcatcgccatggacaagatcatgaccaagcgcatctggcgcttcgagggtctg
cccacgcccgactggcggctggtcgccagcgccgacgagacccgcgccgcgctgcaggcg
ctgggcgcgcccatgatagtcaagccctcgcgcgagggctcgaccatcggcctgaccaag
gtctggacagccgaggagtgcgagcaggcctatgtgctggcctcccggtacgaccccgaa
gtgctctgcgaagagttcatcgaaggcgacgaaaccacctgccccgtgctcggaaccggc
gagggcgcccacgccctgcccgtgatccgcatcgtcgcgcccgaaggcaactacgactac
cagaacaagtacttcaccgacgacacccagtaccactgccccagcggcctgcctgccgag
gaagaggccgagatccggcgcatcgtcgtgcgggccttccgcacgctgggctgccgcggc
tggtcgcgcgccgacatcatgatccgcgccagcgaccgcaagcccttcctgctggagatc
aacacctcgccgggcatgacaggccactcgctggtgcccatgtcggcccgcgccatcggc
gtgagctacgaaaacctgtgcctgggcatcctggccagcgccgcgctggacgcgcaaccg
gagcaggagcacgcatga

DBGET integrated database retrieval system