KEGG   Delftia tsuruhatensis: BI380_21095Help
Entry
BI380_21095       CDS       T04496                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00030  Pentose phosphate pathway
dts01100  Metabolic pathways
dts01110  Biosynthesis of secondary metabolites
dts01120  Microbial metabolism in diverse environments
dts01130  Biosynthesis of antibiotics
dts01200  Carbon metabolism
dts01230  Biosynthesis of amino acids
Module
dts_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BI380_21095
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    BI380_21095
Enzymes [BR:dts01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     BI380_21095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AOV03668
UniProt: A0A1D8J4L5
LinkDB All DBs
Position
4551393..4552400
Genome map
AA seq 335 aa AA seqDB search
MNMPLAIPKPRPTTSAMIASIAAEGQRVQAAPFGKALVELAASRPDVVGLTADLAKYTDL
HLFAQAHPERFFQMGMAEQLLMAAAGGMAKEGLTPFATTYAVFGTRRAYDFIHQVIAEDN
LDVKICCALPGLTTGYGPSHQATDDLAMMRAVPGLIIVDPCDALDITQAVPQIAAHRGPV
YMRLLRGNVPLVLDEYDYRFELGKAKMLREGREVLIICSGFMTMRALEAAQLLATDNVGA
AVLHCATIKPLDVQAIVQAVASGPRLVVVAENHSVVGGLGEAVAGALLERDVRPARFRLA
GLPDAFLDAGALPTLHERYGISAQALAGRIRQWLG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcctcttgccatccccaagccccggccgaccacctcggccatgatcgcctcc
atcgcggccgaaggccagcgcgtgcaggccgcgcctttcggcaaggccctggtggagctg
gccgccagccgccccgacgtggtcggcctgaccgccgacctggccaagtacaccgacctg
cacctgttcgcccaggcccaccccgagcgcttcttccagatgggcatggccgagcagttg
ctgatggccgccgccggcggcatggccaaggaggggctcacgccgtttgccaccacctat
gccgtcttcggcacgcgccgcgcctacgacttcatccaccaggtgattgccgaggacaac
ctggacgtcaagatctgctgcgccctgcccggcctgaccacgggctacggccccagccac
caggccacggacgacctggccatgatgcgggccgtgccgggactgatcatcgtcgatccc
tgcgatgcgctggacatcacccaggccgtgccgcagatcgcggcgcaccgcggccccgtc
tacatgcggctgctgcgcggcaacgtgccgctggtgctggacgagtacgactaccggttc
gagctgggcaaggccaagatgctgcgcgagggccgcgaggtgctcatcatctgcagcggc
ttcatgaccatgcgcgcgctggaggccgcccagctgctggccacggacaacgtgggcgcc
gccgtgctgcactgcgccaccatcaagccgctggatgtgcaggccatcgtgcaggccgtg
gccagcgggccgcgcctggtggtggtggcggagaaccattcggtggtgggcggcctgggc
gaggccgtggccggcgctctgctggagcgcgacgtgcggcccgcgcgctttcggctggcg
ggcctgcccgacgccttcctcgacgcgggcgccctgcccacgctgcatgagcgctacggc
atcagcgcccaggcgctggcgggacgcatccggcagtggctggggtag

DBGET integrated database retrieval system