KEGG   Delftia tsuruhatensis: BI380_21955Help
Entry
BI380_21955       CDS       T04496                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BI380_21955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dts02000]
    BI380_21955
Enzymes [BR:dts01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BI380_21955
Transporters [BR:dts02000]
 Other Transporters
  Pores ion channels [TC:1]
   BI380_21955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_3 GST_C_2 GST_C_3 GST_N GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AOV03817
UniProt: A0A072TN03
LinkDB All DBs
Position
complement(4743709..4744317)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIVLHEAGLAYEPVLASTKTHKLQDGTDYYGINPLGYVPFLVLDDG
DTLHEGPAIVQYLADLVPEKKLAPANGTMARYHLQEWLNFIGTELHKGFGPLFNPATPDD
YKPVVRQRVLDRLKWVDGELNGRDYLMGEQFTVADAYLFTVTGWAQFVGVDISELTNLLA
YRERVLARPAVQAAMKAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacagccctggcgcctgctctctgtctccccacatcgtcctgcacgag
gcaggcctggcctacgagccggtcctggccagcaccaagacgcacaagctgcaggacggc
acggactactacggcatcaacccgctgggctatgttcccttcctcgtgctcgacgacggc
gacacgctgcatgaaggcccggccatcgtccagtacctggccgatctggtccccgagaag
aagctggccccggccaacggcaccatggcccgctaccacctgcaggagtggctgaacttc
atcggcaccgagctgcacaagggcttcggtcccctgttcaaccccgccacgcccgacgac
tacaagcccgtggtgcgccagcgcgtgctggaccgcctcaagtgggtggacggcgagctc
aatggccgcgactacctgatgggcgagcagttcaccgtggccgacgcctacctgttcacc
gtgacgggctgggcccagttcgtgggcgtggacatctccgagctgaccaacctcctggcc
taccgcgagcgcgtgctggcccgccctgccgtgcaggccgcgatgaaggccgaaggcctg
ctcaagtaa

DBGET integrated database retrieval system