KEGG   Delftia tsuruhatensis: BI380_22680Help
Entry
BI380_22680       CDS       T04496                                 

Definition
(GenBank) o-succinylbenzoate--CoA ligase
Organism
dts  Delftia tsuruhatensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AOV03955
UniProt: A0A1D8J5M2
LinkDB All DBs
Position
complement(4907320..4908828)
Genome map
AA seq 502 aa AA seqDB search
MSQRIHHLLDRWLAEAPQRPFIHLPDGSSLSFADLGALADTAEAELRALQVRPGDRVLVV
AENCPEHAALILACSRVGAWSCGVNARMAPGEIDAFAAKADARVVYFTSAASDSASGHAR
RFGAGDSALAGMQHSPVRTQAVAESGALQDEVAALIFTSGTTGTPKGVMVGHDALTLFAR
VSATSRGLGPQDRSYAFVPMTHIFGLGTVLLASLHAGAQMVMRPQFDPADLLDALARHGI
SQLQGPPALYARLLAHLQEQGIAHPQAPALRYVYTGAGPLDLTLKKRVEAAFGQALHHGY
GLSEYAGSVHLTRQGEQRPDTSAGYVVEGAEVRAVDPATGRPLPVGERGELWIRGRGLMH
GYFRDDQATAAVMREGGWYASGDLGELHADGALFVVGRLKEMIIRSGFNVYPAEVELALN
ELPGVQRSAVVGRPETDGNEEVIAFVELQPGATLDNAAARAHLRERLAPYKLPARIVPLS
ELPTSPNGKVLKRLLQEQALRV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacgaatacaccatctgctggaccgctggctggccgaagcgccgcagcgtccc
ttcatccacctgcccgacggcagcagcctgagctttgccgacctgggcgcgctggcggac
acggccgaggccgagctgcgcgcgctgcaggtgcggcccggcgaccgcgtgctggtcgtg
gccgagaactgccccgagcatgcggcgctgatcctggcctgcagccgcgtgggcgcctgg
tcctgcggcgtgaacgcacgcatggcgcccggcgagatcgatgcctttgcggccaaggcc
gacgcccgcgtggtgtatttcacctcggccgcatcggacagcgccagcggccacgcgcgg
cgctttggcgcaggcgactcggccctggccggcatgcagcacagccccgtgcgcacgcag
gccgtggccgaatccggtgcgctgcaggacgaggtggcggcgctgatcttcacctcgggc
accacgggcacgcccaagggcgtgatggtgggacatgacgcgctgacgctgttcgcgcgc
gtctcggccacatcccgcggcctgggtccgcaggaccgcagctacgccttcgtgcccatg
acccacatcttcgggctgggcacggtgctgctggcctcgctgcatgcgggcgcgcagatg
gtgatgcgcccgcagttcgaccccgccgacctgctggacgcgctggcgcgccacggcatc
tcgcagttgcaggggccgccagcgctgtacgcgcgcctgctggcccatctgcaggagcag
ggcattgcccacccgcaggcgccggcgctgcgctatgtctacacaggcgcaggcccgctg
gacctgacgctcaagaaacgcgtggaggccgccttcggccaggcgctgcaccatggctac
ggcctgtcggaatacgcagggtcggtccacctcacgcgacagggcgagcagcggcccgac
accagcgccggctacgtggtggaaggcgccgaggtgcgcgccgtggacccggccacgggc
cggcccctgccggtgggcgagcgcggcgagctgtggatacgcgggcgcggcctgatgcac
ggctacttccgcgatgaccaggccacggccgccgtgatgcgcgagggcggctggtacgcc
agcggcgacctgggcgagctgcatgccgacggcgcgctcttcgtggtggggcggctcaag
gaaatgatcatccgctcgggcttcaacgtgtatccggccgaggtggaactggcgctcaac
gagctgcccggcgtgcagcgcagcgccgtggtcggccgccccgaaaccgatggcaacgag
gaggtcatcgccttcgtcgaactgcagcccggcgccacgctggacaacgctgccgcgcgt
gcccacctgcgagaacggctggcgccctacaagctgcccgcccgcatcgtgcccctgtcc
gagctgcccaccagccccaacggcaaggtgctcaagcgcctgctgcaggaacaggcgctg
cgcgtttga

DBGET integrated database retrieval system