KEGG   Delftia tsuruhatensis: BI380_23900Help
Entry
BI380_23900       CDS       T04496                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
dts  Delftia tsuruhatensis
Brite
KEGG Orthology (KO) [BR:dts00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dts03012]
    BI380_23900
   03029 Mitochondrial biogenesis [BR:dts03029]
    BI380_23900
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dts04147]
    BI380_23900
Translation factors [BR:dts03012]
 Eukaryotic Type
  Elongation factors
   BI380_23900
 Prokaryotic Type
   BI380_23900
Mitochondrial biogenesis [BR:dts03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BI380_23900
Exosome [BR:dts04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BI380_23900
  Exosomal proteins of breast cancer cells
   BI380_23900
  Exosomal proteins of colorectal cancer cells
   BI380_23900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AOV04166
UniProt: A0A1D8J660
LinkDB All DBs
Position
5178522..5179712
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLAKYDFPGDDTPIIRGSAKLALE
GDASDKGEPAILRLAEALDTYIPTPERAVDGAFAMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGIRDTQKTIVTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPADKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaaattcgagcggaccaagccccacgtcaacgtgggcaccatcggtcac
gtggaccacggcaagacgaccctgacggctgccatcgccaccgttctgtccaagaagttc
ggcggcgaagccaaggcttacgaccagatcgacgcagcacctgaagaaaaggcccgcggc
atcacgatcaacaccgcccacgtcgagtacgaaacggccaaccgccactacgctcacgtt
gactgccccggccacgccgactacgtcaagaacatgatcaccggcgctgctcagatggac
ggcgctatcctggtgtgctcggccgctgacggcccgatgccccagacccgcgagcacatc
ctgctggctcgtcaggtgggcgtgccctacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgaagagctgctggagctggtcgaaatggaagtgcgcgagctgctggccaag
tacgacttccccggcgacgacacccccatcatccgcggctcggccaagctggccctggaa
ggtgacgcaagcgacaagggcgagcccgccatcctgcgtctggctgaagccctggacacc
tacatccccacgcccgagcgcgctgtggacggtgccttcgcaatgcccgtggaagacgtg
ttctcgatctccggccgtggcaccgtggtgaccggtcgcgttgagcgcggcatcatcaag
gtcggcgaagaaatcgaaatcgtcggtattcgcgacacccagaagaccatcgtcaccggc
gtggaaatgttccgcaagctgctggaccaaggccaggctggcgacaacgtgggcctgctg
ctgcgcggcaccaagcgtgaagacgtggaacgcggccaagtgctgtgcaagcccggctcc
atcaagccccacacccacttcacggctgaggtgtacgtgctgtccaaggacgaaggtggt
cgccacactccgttcttcaacaactaccgtccccagttctatttccgcacgaccgacgtg
accggctccatcgagctgcccgccgacaaggaaatggtgatgcctggcgataacgtgtcg
atcaccgtcaagctgatcgcccccatcgccatggaagaaggtctgcgcttcgctatccgc
gaaggcggccgtaccgtgggcgctggcgtggttgcaaagatcattgcgtaa

DBGET integrated database retrieval system