KEGG   Delftia tsuruhatensis: BI380_27240Help
Entry
BI380_27240       CDS       T04496                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dts01100  Metabolic pathways
dts01110  Biosynthesis of secondary metabolites
dts01130  Biosynthesis of antibiotics
dts01230  Biosynthesis of amino acids
Module
dts_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BI380_27240
Enzymes [BR:dts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BI380_27240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 AAA_17 Cytidylate_kin2 KTI12 Cytidylate_kin AAA_22 CoaE AAA_16 AAA ABC_tran AAA_28 AAA_5 NACHT AAA_30 6PF2K Ploopntkinase3 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AOV06103
UniProt: A0A1D8JBM3
LinkDB All DBs
Position
5953397..5953903
Genome map
AA seq 168 aa AA seqDB search
MVALIGLPGSGKSTIGRQLARLWSMRFVDSDHVIEQRLGCSIREFFEREGEQAFRDMESQ
VIDELSASTSSLLLSTGGGVVLREQNRRHLHERTQVFYLDCTPEDIAARLRNDVTRPLLQ
VEDPALRLRELLLQREPLYLETAHFVIQTSGLSVAQAAQRIRMQAELA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtggtggccctgatcggcctgcccggctccggcaaatcgaccatagggcgccagctggcg
cgcctgtggtcgatgcgttttgtggattcggaccatgtgatcgagcagcgcctgggctgc
agcatccgggagtttttcgagcgcgagggcgagcaggcttttcgcgacatggagtcgcag
gtcattgatgagctgtcggcctccacatccagcctgctgttgtccacgggcggtggcgtg
gtgctgcgggagcaaaaccgccgccatctgcatgagcgcacccaggtcttctacctggat
tgcacgccagaggacatcgccgcgcggctgcgcaacgatgtgacgcggcccttgctgcag
gtggaggatccggcgttgcgcctgcgcgagttgctgctgcagcgcgagcccctgtatctg
gagacggcgcacttcgtgatccagacatccggcctgtctgtggcgcaggccgcccagcgc
atacgcatgcaggcggaactggcctga

DBGET integrated database retrieval system