KEGG   Delftia tsuruhatensis: BI380_28865Help
Entry
BI380_28865       CDS       T04496                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00630  Glyoxylate and dicarboxylate metabolism
dts01100  Metabolic pathways
dts01110  Biosynthesis of secondary metabolites
dts01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BI380_28865
Enzymes [BR:dts01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     BI380_28865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-ProteinID: AOV05056
UniProt: A0A1D8J8L3
LinkDB All DBs
Position
6333592..6334278
Genome map
AA seq 228 aa AA seqDB search
MTTPGSSEIYRARRFDLIAFDWDGTLSDSTAVIVKCIQAAVADVGGTPPSNEAASYVIGM
ALMPALARAAPDVSPEKYPELGNRYRHHFIKHQDDISLFAGVLPMLAALRERGHLLAVAT
GKSRRGLNDALQDPQLRGMFDSSRTADETAGKPNPLMLQELMAEFGVEPGRVLMIGDTTH
DLELARNAGCASVGVGYGAHPTDGFGVLQPLHVAQSVADLHQWLLAHG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcctggttcttccgagatataccgtgcgcgccgcttcgacctcatcgccttc
gactgggatgggacgctgtcggattccaccgcggtgatcgtcaagtgcattcaggcggcc
gtggccgatgtgggaggcacgccccccagcaatgaggcggcctcctatgtgatcggcatg
gcgctgatgccggcattggcgcgtgcggcgcccgatgtgtcgcccgagaaatacccggag
ctgggcaaccgctatcgccaccatttcatcaagcatcaggacgacatcagcctgttcgcc
ggcgtgctgcccatgctggcggcgctgcgcgagcgcggccacctgctggccgtggccacg
ggcaagagccggcgcggtctgaacgatgcgctgcaggacccgcaactgcgcggcatgttc
gacagctcgcgcacggcggacgaaaccgccggcaagcccaacccgctgatgctgcaggag
ctgatggccgaattcggcgtggagcctggccgcgtgctgatgatcggcgacaccacgcac
gatctggaactggcccgcaatgctggctgtgccagcgtgggcgtgggctatggcgcgcat
cccaccgacggctttggcgtgctgcagccgttgcatgtggcgcagagtgttgcggatttg
catcagtggctgctggcccatggttga

DBGET integrated database retrieval system