KEGG   Delftia tsuruhatensis: BI380_29910Help
Entry
BI380_29910       CDS       T04496                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dts  Delftia tsuruhatensis
Brite
KEGG Orthology (KO) [BR:dts00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BI380_29910
Enzymes [BR:dts01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BI380_29910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_oxidored GIDA FAD_binding_2 HI0933_like DAO NAD_binding_8 FAD_binding_3 AlaDh_PNT_C Thi4 Glutaredoxin DSBA Thioredoxin_4 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AOV05248
UniProt: A0A072TEZ7
LinkDB All DBs
Position
6557107..6558663
Genome map
AA seq 518 aa AA seqDB search
MLDNNLKAQLQAYLERLQRPVELVASLDDSQGARELKELLLEIRELSDKITVVEHNDAEV
RKPSFLITNPGVDSGVRFAGVPLGHEFTSLVLALLQVGGHPSKESAELLEQVRNIDVPLH
FETYYSLSCHNCPDVVQALNLMSVLNPKISHTAIDGGLFQKEVEQREVMGVPTVFVNGER
FGQGRMELAEIVAKVDTGAASREAARISAKDAFDVLIVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTVDIENFISVSKTEGPQLAAAMERHVRDYEVDIMNLQTASKLIPAATEG
GLIEVQTASGASLKAKTVILSTGARWRNMNVPGEDKYRTKGVTYCPHCDGPLFKGKNVAV
IGGGNSGVEAAIDLAGIVRSVTLLEFASELKADAVLQKKLKSLPNVTVILNAQTTEVNGD
GKKVTGLTYKDRTTEEVKTVALEGIFVQIGLLPNTDWLKGTVELTRFGEIVIDAKGHTSV
PGVFAAGDCTNVPYKQIIIAAGAGSTAALSAFDHLIRH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacaacaacctgaaagcccaattgcaggcctacctggagcgcctgcagcgtccg
gtggagctggtggcttcgctggatgacagccagggtgcgcgcgagctgaaggaactgctg
ctggaaatccgcgagctgagcgacaagatcaccgtcgtcgagcacaacgacgccgaggtg
cgcaagccctcgttcctgatcaccaatcccggcgtggacagcggcgtgcgtttcgcaggc
gtccccctgggccatgaattcacctcgctggtgctggccctgctgcaggtcggcggccat
ccgtccaaggaatcggccgaactgctggagcaggtgcgcaatatcgacgtgccgctgcac
ttcgagacctattactcgctgtcctgccacaactgtcccgacgtggtgcaggcgctgaac
ctgatgtccgtgctcaatcctaagatcagccataccgccatcgacggcgggctgttccag
aaggaagtcgagcagcgcgaagtcatgggcgtgcccacggtcttcgtcaatggcgagcgc
ttcggccagggccgcatggagctggccgagatcgtcgccaaggtcgacaccggcgccgct
tcgcgtgaagcggccaggatttccgccaaggacgccttcgacgtgctgatcgtcggtggc
ggccccgccggcgcggccgctgccatctatgcggcacgcaagggcatccgcaccggcatt
gccgccgagcgcttcggcggccaggtgctggacaccgtggacatcgagaacttcatctcg
gtctccaagaccgaaggccctcagctggccgccgccatggagcgccatgtgcgcgactac
gaggtggacatcatgaacctgcagacggcgtccaaactgattccggctgccacggaaggc
gggctgatcgaggtgcagaccgcctcgggcgccagcctcaaggccaagaccgtcatcctc
tcgaccggcgcgcgctggcgcaacatgaacgtgccgggcgaggacaagtaccgcaccaag
ggcgtgacctactgcccgcactgcgacggaccgctgttcaagggcaagaatgtggccgtc
atcggcggcggcaactcgggcgtggaagcggccatcgacctggccggcatcgtgcgcagc
gtgacgctgctggagttcgccagcgagctcaaggccgatgccgtgctgcaaaagaagctc
aagagcctgcccaatgtgaccgtcatcctcaacgcccagaccaccgaggtcaacggcgac
ggcaagaaggtcaccggcctgacctacaaggaccgcacgacggaagaggtcaagaccgtg
gcgctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgactggctcaagggc
acggtggagctgacccgcttcggcgagatcgtgatcgatgccaagggccacaccagcgtg
cccggcgtgttcgccgcaggcgactgcaccaacgtgccgtacaagcagatcatcatcgct
gccggtgccggctccacggctgcgctgtcggccttcgaccacctgatccgccactga

DBGET integrated database retrieval system