KEGG   Delftia tsuruhatensis: BI380_30980Help
Entry
BI380_30980       CDS       T04496                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00061  Fatty acid biosynthesis
dts00780  Biotin metabolism
dts01100  Metabolic pathways
dts01212  Fatty acid metabolism
Module
dts_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BI380_30980
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BI380_30980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dts01004]
    BI380_30980
Enzymes [BR:dts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BI380_30980
Lipid biosynthesis proteins [BR:dts01004]
 Fatty acid synthase
  Component type
   BI380_30980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AOV05437
UniProt: A0A072TEL2
LinkDB All DBs
Position
6795841..6796281
Genome map
AA seq 146 aa AA seqDB search
MMDIHAILKQLPHRYPFLLVDKVTELERNTRIKAIKNVTFNEPYFMGHFPGRPVMPGVLI
LEALAQAAGLLAFDAMGQVPDENNIYYFVGIDGARFKRPVEPGDQLVLEITIDRVRGGIW
KFKGVARVEDEVACEAELMCTMRNVG
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggatattcacgcaattctcaagcaactgccccaccgctaccccttcctgctggtg
gacaaggtcacggagcttgagcgcaatacacgcatcaaggcgatcaagaacgtcacgttc
aacgagccctatttcatgggccatttcccaggccgtcccgtcatgccgggcgtgctcatc
ctggaggcgctggcgcaggctgccggcctgctggccttcgatgccatgggccaggttccc
gacgaaaacaacatctactacttcgtgggcatcgacggggcgcgcttcaagcgtcccgtg
gagccgggcgaccagctggtgctggagatcaccatcgaccgtgtgcgcggcggcatctgg
aagttcaagggcgtggctcgcgtcgaagacgaagtggcctgcgaagccgagctgatgtgc
accatgcgcaacgtgggctga

DBGET integrated database retrieval system