KEGG   Delftia tsuruhatensis: BI380_31575Help
Entry
BI380_31575       CDS       T04496                                 

Definition
(GenBank) fatty-acid--CoA ligase
Organism
dts  Delftia tsuruhatensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AOV05544
UniProt: A0A1D8JA18
LinkDB All DBs
Position
complement(6929239..6930801)
Genome map
AA seq 520 aa AA seqDB search
MPMYLTQAIHKGRRERAGATAAICGAEQASWSQLAQRIERCAGLLRALDVAPGDRVGMMG
LNSIRYLEYFYGCWWAGAAVNPVNIRWSAHEVAYSLDDCDTRVLFVDDAFAPLVPRLREL
SSSLRTVVFCGTGAAPEGALHYEQLLAAATPCADALRSGNDLAAVMYTGGTTGRPKGVML
SHDNLFINALSNASNVPRQHVKVGMVVTPMFHVAGCGLALLMAQRLVPQVIVPAFDELAI
LNGIQQHGVNELFLVPTMIRRLIEHPRLAEFDLSSLRLMLYGAAPIDATLLERAMQLLPG
ADFAQAYGMTELSPTIVSMGPAEHRPGPQRERLLRAAGRPVTIAEVRIVDGEGRELPPGE
VGEITARGPMVMQGYWNRPAETAAALKDGWMHTGDMGRLDADGYLFVVDRLKDMIVSGGE
NVYSAEVENAIAQLPQVAMCAVIGVPDERWGERVHAVIVAREGQPLTEAEVIAHCRERIA
GYKCPRSVEFRSELPLSAAGKLQKFQLREPYWQGRERRIN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgtatctcacccaggccatccacaagggccgccgcgaaagggccggcgccacg
gcagccatctgcggcgcagagcaggccagctggtcgcagcttgcgcagcgcatcgaacgc
tgtgccggcctgctgcgggcgctggacgtggcgcccggcgaccgcgtcggcatgatgggc
ctgaactccatccgctaccttgaatacttctatggctgctggtgggcaggcgccgcggtc
aaccccgtcaacatccgctggagcgcgcacgaggtggcctactcgctggacgactgcgac
acgcgcgtgctcttcgtggacgatgccttcgcgcccctggtgccccggctgcgcgagctg
tcctccagcctgcgcaccgtggtgttctgcggcaccggcgccgcgcccgaaggcgcgctg
cactacgagcaattgctggccgccgccacgccctgcgccgacgcgctgcgcagcggcaac
gacctggctgccgtgatgtatacgggcggcaccacgggccggcccaagggggtgatgctc
agccacgacaacctgttcatcaacgccctgtccaatgccagcaacgtgccgcgccaacat
gtgaaggtgggcatggtggtcacgcccatgttccatgtggccggctgcggcctggccctg
ctcatggcccagcgcctggtgccccaggtcatcgtgccggccttcgacgagctggccatc
ctgaacggcatccagcagcacggcgtgaacgagctgttcctggtgcccaccatgatccgc
cggctgatcgagcatccgcgcctggccgaattcgatctgtccagcctgcgcctcatgctc
tatggcgcggcgcccatcgatgccaccttgctggagcgcgccatgcagctactgcccggc
gccgacttcgcccaggcctacggcatgaccgagctgtcgcctaccatcgtgtccatgggc
ccggccgagcaccgtcccggcccgcagcgcgagcgcctgctgcgcgcggccggccggccc
gtgaccattgccgaggtgcgcatcgtcgatggcgagggccgcgagctgccgcccggcgag
gtgggcgagatcacggcgcgcggccccatggtcatgcagggctactggaacaggcccgcc
gagacggccgccgcgctcaaggacggctggatgcacacgggcgacatgggccggctggat
gccgacggctacctcttcgtcgtggaccggctcaaggacatgatcgtcagcggcggcgag
aacgtgtattcggccgaggtcgagaacgccatcgcccagctgccccaggtcgccatgtgc
gccgtcatcggcgtgcccgacgaacgctggggcgagcgcgtgcacgccgtgatcgtcgcg
cgcgagggccagccgctgaccgaggccgaggtcatcgcccactgccgcgaacgcatcgcg
ggctacaagtgcccgcgctcggtggagttccgcagcgagctgccgctgtcggccgcgggc
aagctgcagaaattccagctgcgcgagccctattggcagggccgcgaacgccgcatcaac
tga

DBGET integrated database retrieval system