KEGG   Dictyoglomus turgidum: Dtur_0685Help
Entry
Dtur_0685         CDS       T00800                                 

Definition
(RefSeq) alcohol dehydrogenase GroES domain-containing protein
Organism
dtu  Dictyoglomus turgidum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 7083347
NCBI-ProteinID: YP_002352584
UniProt: B8DZN7
LinkDB All DBs
Position
696194..697210
Genome map
AA seq 338 aa AA seqDB search
MIAAVWKNRRISLENLPNPIIEKGDEVIIKVLASGICGTDLHVFSGKAYGKDGIIRGHEF
SGRVVEVGKETKGIKVGDLVAVDPNITCGYCYFCKRGEVNLCENLIALGVDIDGGFAEYC
IVPYKQLYVFSSKISPVEGAMMEPVACALHGIERLNIKSGDVVLIVGGGALGLILLQLAK
LSGASKVFLVEKVEWKREIAKELGADVIISPEENVVEIIKENNKGRGVDVGIEAVGKGET
VRLTLENVRRGGKVLIFGVSSPEDLISISTYDIYFKELTIMGSFVNPFTNSKALSLIEEG
KINVKRVVSHEFPIEKIEEGIKMGLSGDALRVMITFKE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagcagtatggaagaatagaagaatatccttagagaatttacctaatcctatc
attgaaaaaggtgatgaagttattattaaagttcttgcttcgggcatatgtggcactgat
cttcatgtgttttcaggaaaggcatatggcaaagatggaataataaggggacacgaattc
tcaggaagagtggttgaagtaggtaaagaaactaaagggataaaggtaggagatctggta
gctgttgaccctaatataacttgtggctattgttatttttgtaagaggggagaagtaaat
ctttgtgagaatcttattgctttaggtgtagatatagatggaggttttgcagaatactgc
atagtgccttataaacagctttatgttttttctagcaaaatctcccctgtagaaggagca
atgatggaacctgtggcatgtgctcttcatggaattgagagattaaatattaaatcgggg
gatgtagtgcttattgtaggaggaggcgcccttggattgatattactgcaacttgcaaaa
ctttctggggcttctaaggtctttttggtggaaaaggtagaatggaaaagagagattgca
aaagagcttggggctgatgtgattataagccctgaggagaatgtggtagagattattaaa
gagaataataaagggagaggggtagatgtgggaattgaggcggtaggaaaaggggagact
gtgagacttaccttggaaaatgtaagaaggggaggaaaagttttaatatttggagtatcc
tctcctgaggatttaattagcatttctacctatgacatatactttaaagagttaactatt
atgggctcttttgttaatccttttaccaattcaaaggctctctcccttattgaagagggg
aagataaatgtgaaaagagttgtttctcatgagtttcctatagagaagatagaagaagga
ataaagatggggctttctggggatgctttgagggtaatgataacttttaaggagtga

DBGET integrated database retrieval system